CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

NFIA_065310 *(Neosartorya fischeri)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	CADNFIAG00006112	T362534_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ASG1 M00088_2.00	Saccharomyces cerevisiae	CGGRDNN	NNHYCCG	PBM Badis et al.(2008) ASG1_2140	0.603	0.763
ASG1 M01581_2.00	Saccharomyces cerevisiae	NCGGNDNN	NNHNCCGN	PBM Zhu et al.(2009) Asg1	0.603	0.763
ASG1 M07515_2.00	Saccharomyces cerevisiae	CCGGAW	WTCCGG	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0275.1	0.603	0.763
ASG1 M08666_2.00	Saccharomyces cerevisiae	CCGGAW	WTCCGG	Misc DeBoer et al.(2011) YIL130W_529	0.603	0.763
ASG1 M08667_2.00	Saccharomyces cerevisiae	CCGGVWMHMDBCCGGD	HCCGGVHKDKWBCCGG	Misc DeBoer et al.(2011) YIL130W_807	0.603	0.763
NCU00155 M02583_2.00	Neurospora crassa	NNCGGNNNN	NNNNCCGNN	PBM Weirauch et al.(2014) pTH8610	0.592	0.868
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CADNFIAP00005955	Zinc cluster	73	110	RACDECRRKKIKCDGKQPCTHCTVYSYECTYDQPSNRR

Links
Other Zinc cluster family TFs
Other *Neosartorya fischeri* TFs