CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Kpol_1023p41 *(Vanderwaltozyma polyspora)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	Kpol_1023p41	T371868_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RSC3 M00082_2.00	Saccharomyces cerevisiae	GCGCGCGG	CCGCGCGC	PBM Badis et al.(2008) RSC3_2035	0.609	0.816
RSC3 M01576_2.00	Saccharomyces cerevisiae	NNNNNSCGNN	NNCGSNNNNN	PBM Zhu et al.(2009) Rsc3	0.609	0.816
RSC3 M07509_2.00	Saccharomyces cerevisiae	NNVCGCG	CGCGBNN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0374.1	0.609	0.816
RSC3 M08655_2.00	Saccharomyces cerevisiae	NNVCGCG	CGCGBNN	Misc DeBoer et al.(2011) YDR303C_580	0.609	0.816
RSC30 M00086_2.00	Saccharomyces cerevisiae	NGCGCGCGSN	NSCGCGCGCN	PBM Badis et al.(2008) RSC30_2087	0.539	0.763
RSC30 M01580_2.00	Saccharomyces cerevisiae	NNDCGSVNN	NNBSCGHNN	PBM Zhu et al.(2009) Rsc30	0.539	0.763
RSC30 M07513_2.00	Saccharomyces cerevisiae	VSCGCGCS	SGCGCGSB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0375.1	0.539	0.763
RSC30 M08663_2.00	Saccharomyces cerevisiae	HNHVHCSCGCGCGSGNDVSVN	NBSBHNCSCGCGCGSGDBDND	Misc DeBoer et al.(2011) YHR056C_857	0.539	0.763
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EDO18872	Zinc cluster	13	51	PACVQCRRRKIGCDRGKPICGNCAKSHKTDCFYPDVPGA

Links
Other Zinc cluster family TFs
Other *Vanderwaltozyma polyspora* TFs