CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GLYMA01G42500 *(Glycine max)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	GLYMA01G42500	T001726_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ddf2 M00965_2.00	Arabidopsis lyrata	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_lyrata	0.685	0.740
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.679	0.800
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.679	0.800
DREB1F M00962_2.00	Arabidopsis thaliana	NRCCGACNN	NNGTCGGYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_thaliana	0.679	0.760
DREB1F M00840_2.00	Arabidopsis thaliana	NRYCGACNN	NNGTCGRYN	PBM Franco-Zorrilla et al.(2014) DDF1	0.679	0.760
DDF1 M00964_2.00	Arabidopsis lyrata	NRYCGACDY	RHGTCGRYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_lyrata	0.679	0.760
DREB1F M06564_2.00	Arabidopsis thaliana	NHNHYGYCGACATNN	NNATGTCGRCRDNDN	Dap-seq OMalley et al.(2016) DDF1_col_a	0.679	0.760
DREB1F M06565_2.00	Arabidopsis thaliana	HNDNNRYCGACAH	DTGTCGRYNNHND	Dap-seq OMalley et al.(2016) DDF1_colamp_a	0.679	0.760
DREB1F M09701_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1F_03	0.679	0.760
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
GLYMA01G42500.2	AP2	61	112	PVYRGVRRRNKNKWVCEMRVPNNNSRIWLGTYPTPEMAARAHDVAALALRGK

Links
Other AP2 family TFs
Other *Glycine max* TFs

81 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ECPE_0000624401	Echinostoma caproni	ECPE_0000624401	N	0.000
D915_08122	Fasciola hepatica	D915_08122	N	0.000
MCOS_0000566101	Mesocestoides corti	MCOS_0000566101	N	0.000
T265_00242	Opisthorchis viverrini	T265_00242	N	0.000
C_01193	Schistosoma haematobium	C_01193	N	0.000
Sjc_0025520	Schistosoma japonicum	Sjc_0025520	N	0.000
Smp_015670	Schistosoma mansoni	Smp_015670	N	0.000
SMRZ_0001688001	Schistosoma margrebowiei	SMRZ_0001688001	N	0.000
SMTD_0000782201	Schistosoma mattheei	SMTD_0000782201	N	0.000
SMU15000156	Schmidtea mediterranea	SMU15000156	N	0.000
TRE_0001588001	Trichobilharzia regenti	TRE_0001588001	N	0.000