CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Cucsa.064390 *(Cucumis sativus)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Cucsa.064390	T006994_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.857	0.980
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.857	0.980
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.854	0.980
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.711	0.860
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.711	0.860
ERF054 M06647_2.00	Arabidopsis thaliana	NNNNNNNNNHHDSCRCCGHC	GDCGGYGSHDDNNNNNNNNN	Dap-seq OMalley et al.(2016) At4g28140_col_a	0.693	0.840
ERF054 M06648_2.00	Arabidopsis thaliana	NNNNHDBCRCCGHCM	KGDCGGYGVHDNNNN	Dap-seq OMalley et al.(2016) At4g28140_colamp_a	0.693	0.840
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.683	0.660
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Cucsa.064390.1	AP2	173	224	KLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAFKLRGD

Links
Other AP2 family TFs
Other *Cucumis sativus* TFs

457 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
Z519_03831	Cladophialophora bantiana	Z519_03831	N
PV07_03597	Cladophialophora immunda	PV07_03597	N
Z517_01095	Fonsecaea pedrosoi	Z517_01095	N