CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

gw1.20.225.1 *(Physcomitrella patens)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	gw1.20.225.1	T071160_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PK20942.1 M01159_2.00	Cannabis sativa	NNNNDAMAKCTRN	NYAGMTKTHNNNN	PBM Lambert et al.(2019) pTH11276	0.820	0.871
AT1G06070 M06744_2.00	Arabidopsis thaliana	TGMCAGCTGKM	KMCAGCTGKCA	Dap-seq OMalley et al.(2016) bZIP69_col_a	0.787	0.839
AT1G06070 M06745_2.00	Arabidopsis thaliana	TGMCAGCTGKM	KMCAGCTGKCA	Dap-seq OMalley et al.(2016) bZIP69_colamp_a	0.787	0.839
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
gw1.20.225.1	bZIP	119	180	DPKRAKRILANRQSAARSKERKMRYISELERKVQSLQTEATTLSAQLTLLQKDTTSLTTENS

Links
Other bZIP family TFs
Other *Physcomitrella patens* TFs