CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

BGIOSGA034459 *(Oryza indica)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	BGIOSGA034459	T204763_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATH1 M10627_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ATH1_01	0.843	0.755
Q5EVH4_OIKDI M02227_2.00	Oikopleura dioica	NTGACAKN	NMTGTCAN	PBM Weirauch et al.(2014) pTH6041	0.626	0.551
MEIS3 M03093_2.00	Homo sapiens	DTGACANN	NNTGTCAH	SELEX Jolma et al.(2013) MEIS3_1	0.602	0.429
MEIS3 M03094_2.00	Homo sapiens	TGACAGSTGTCA	TGACASCTGTCA	SELEX Jolma et al.(2013) MEIS3_2	0.602	0.429
MEIS3 M04951_2.00	Homo sapiens	TGWCABVTGWCA	TGWCABVTGWCA	SELEX Yin et al.(2017) MEIS3_eDBD_HT-SELEX	0.602	0.429
MEIS3 M04952_2.00	Homo sapiens	YGWCABVTGWCR	YGWCABVTGWCR	SELEX Yin et al.(2017) MEIS3_eDBD_Methyl-HT-SELEX	0.602	0.429
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
BGIOSGA034459-PA	Homeodomain	371	422	ERSVSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVRLWK

Links
Other Homeodomain family TFs
Other *Oryza indica* TFs