CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

PAAG_11867 *(Paracoccidioides sp lutzii)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	PAAG_11867	T222071_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATEG_04171 M02059_2.00	Aspergillus terreus	BWWATKRNNN	NNNYMATWWV	PBM Weirauch et al.(2014) pTH5871	0.808	0.842
YOX1 M00058_2.00	Saccharomyces cerevisiae	HTWAATTR	YAATTWAD	PBM Badis et al.(2008) YOX1_2073	0.613	0.491
YOX1 M01552_2.00	Saccharomyces cerevisiae	BWWATDR	YHATWWV	PBM Zhu et al.(2009) Yox1	0.613	0.491
YOX1 M07487_2.00	Saccharomyces cerevisiae	YTAATTWN	NWAATTAR	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0433.1	0.613	0.491
YOX1 M08575_2.00	Saccharomyces cerevisiae	YTAATTWN	NWAATTAR	Misc DeBoer et al.(2011) YML027W_498	0.613	0.491
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
KGQ01403	Homeodomain	53	109	RQKRRRTSPDDQKILEAEYHRNPKPDRAKRAEIVNRVTLGEKEVQIWFQNRRQNDRR

Links
Other Homeodomain family TFs
Other *Paracoccidioides sp lutzii* TFs