CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Thhalv10014410m.g *(Eutrema salsugineum)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00249 (Myb_DNA-binding)	IPR014778	Thhalv10014410m.g	T290053_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT2G38090 M07055_2.00	Arabidopsis thaliana	HHBAWNYTTATCYWNWHYNBN	NVNRDWNWRGATAARNWTVDD	Dap-seq OMalley et al.(2016) At2g38090_col_a	0.703	0.819
AT5G58900 M07146_2.00	Arabidopsis thaliana	HHWWYCTTATCYWHW	WDWRGATAAGRWWDD	Dap-seq OMalley et al.(2016) At5g58900_col_a	0.697	0.787
AT5G58900 M07147_2.00	Arabidopsis thaliana	HWYMTTATCHWNWWH	DWWNWDGATAAKRWD	Dap-seq OMalley et al.(2016) At5g58900_colamp_a	0.697	0.787
PK27213.1 M01284_2.00	Cannabis sativa	NHWATCNNNN	NNNNGATWDN	PBM Lambert et al.(2019) pTH10196	0.671	0.777
PK27213.1 M02356_2.00	Cannabis sativa	NHHATCNNNN	NNNNGATDDN	PBM Weirauch et al.(2014) pTH9600	0.671	0.777
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10014410m	Myb	145	192	GVPWTEEEHRLFLMGLKKYGKGDWRNIAKNFVTTRTPTQVASHAQKYF

Links
Other Myb/SANT family TFs
Other *Eutrema salsugineum* TFs