CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GH18671 *(Drosophila grimshawi)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	FBgn0126138	T038657_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ato M05960_2.00	Drosophila melanogaster	VCAYMTGNCRY	RYGNCAKRTGB	B1H Zhu et al.(2011) ato_da_SANGER_10_FBgn0010433	0.894	0.981
ato M05961_2.00	Drosophila melanogaster	VCABMTGDC	GHCAKVTGB	B1H Zhu et al.(2011) ato_da_SANGER_5_2_FBgn0010433	0.894	0.981
ato M05962_2.00	Drosophila melanogaster	MCAYMTGNC	GNCAKRTGK	B1H Zhu et al.(2011) ato_da_SANGER_5_3_FBgn0010433	0.894	0.981
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0152577	bHLH	270	322	RRLAANARERRRMQNLNTAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISALG

Links
Other bHLH family TFs
Other *Drosophila grimshawi* TFs