CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

BGIBMGA013687 *(Bombyx mori)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	BGIBMGA013687	T057091_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
slbo M03642_2.00	Drosophila melanogaster	NRTTRCGYAAYN	NRTTRCGYAAYN	SELEX Nitta et al.(2015) slbo_1	0.786	0.695
slbo M03643_2.00	Drosophila melanogaster	NRTTRCGYAAYN	NRTTRCGYAAYN	SELEX Nitta et al.(2015) slbo_2	0.786	0.695
slbo M06021_2.00	Drosophila melanogaster	ATTRCVMA	TKBGYAAT	B1H Zhu et al.(2011) slbo_FlyReg_FBgn0005638	0.786	0.695
slbo M06022_2.00	Drosophila melanogaster	DRTKWCGYAAB	VTTRCGWMAYH	B1H Zhu et al.(2011) slbo_SANGER_5_FBgn0005638	0.786	0.695
slbo M07540_2.00	Drosophila melanogaster	ATTRCVMA	TKBGYAAT	DNaseI footprinting Mathelier et al.(2014) MA0244.1	0.786	0.695
slbo M10035_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$CEBP_Q6	0.786	0.695
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
BGIBMGA013687-TA	bZIP	187	245	DEYRRRRERNNIAVRKSREKAKVRSREVEEKVKTLLREKEALLKRLEAVSGELSLHKQM

Links
Other bZIP family TFs
Other *Bombyx mori* TFs