CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo00615s190 *(Brassica oleracea)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Bo00615s190	T057238_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TGA4 M01786_2.00	Arabidopsis thaliana	RVTKACGTND	HNACGTMABY	PBM Weirauch et al.(2014) pTH8278	0.798	1.000
TGA4 M06788_2.00	Arabidopsis thaliana	TSACGTCAKCD	HGMTGACGTSA	Dap-seq OMalley et al.(2016) TGA4_col_a	0.798	1.000
TGA4 M06789_2.00	Arabidopsis thaliana	DRTGACGTCAKCDNH	DNHGMTGACGTCAYH	Dap-seq OMalley et al.(2016) TGA4_colamp_a	0.798	1.000
TGA1 M01788_2.00	Arabidopsis thaliana	NVTGACGHNN	NNDCGTCABN	PBM Weirauch et al.(2014) pTH7231	0.798	0.979
TGA1 M01134_2.00	Arabidopsis thaliana	NVTKACGHNN	NNDCGTMABN	PBM Lambert et al.(2019) pTH7599	0.798	0.979
TGA1 M06793_2.00	Arabidopsis thaliana	HNDVTGACGTCAKCD	HGMTGACGTCABHND	Dap-seq OMalley et al.(2016) TGA1_colamp_a	0.798	0.979
TGA1 M06794_2.00	Arabidopsis thaliana	DRTGACGTCAKCDDH	DHHGMTGACGTCAYH	Dap-seq OMalley et al.(2016) TGA1_col	0.798	0.979
TGA1 M02657_2.00	Arabidopsis thaliana	HNACGTCABSV	BSVTGACGTND	SELEX Mathelier et al.(2014) MA0588.1	0.798	0.979
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo00615s190.1	bZIP	82	129	RHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIHLEQELDRA

Links
Other bZIP family TFs
Other *Brassica oleracea* TFs