Zfp28 (Rattus norvegicus)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source Animal TF db
PF00096 (zf-C2H2) IPR007087 ENSRNOG00000042777 T109237_2.00 Ensembl (2018-Dec-8) Link out
NCBI Gene Info:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Orthologous to human ZFP28 (ZFP28 zinc finger protein). [provided by Alliance of Genome Resources, Apr 2022]

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score		 DBD
Identity
No direct experiments

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score		 DBD
Identity
ZFP28
M08378_2.00 		Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK
NAYMNHWRARGAAAHDGARMKVHHDNDNND		 ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE 		0.758 0.914
ZFP28
M08949_2.00 		Homo sapiens
YTCTRTTTCTTCTKRWGTCA
TGACWYMAGAAGAAAYAGAR		 Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C 		0.758 0.914
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSRNOP00000020523 C2H2 ZF 273 295
ENSRNOP00000020523 C2H2 ZF 301 323
ENSRNOP00000020523 C2H2 ZF 329 352
ENSRNOP00000020523 C2H2 ZF 358 380
ENSRNOP00000020523 C2H2 ZF 386 408
ENSRNOP00000020523 C2H2 ZF 414 436
ENSRNOP00000020523 C2H2 ZF 442 464
ENSRNOP00000020523 C2H2 ZF 470 492
ENSRNOP00000020523 C2H2 ZF 498 520
ENSRNOP00000020523 C2H2 ZF 526 548
ENSRNOP00000020523 C2H2 ZF 554 576
ENSRNOP00000020523 C2H2 ZF 582 604
ENSRNOP00000020523 C2H2 ZF 610 632
ENSRNOP00000020523 C2H2 ZF 638 660

Links

Other C2H2 ZF family TFs
Other Rattus norvegicus TFs

23 Related TFs

Name Species Gene ID Motif Evidence SR
Score		 Action
Zfp28 Mus musculus ENSMUSG00000062861 N 0.821
ZFP28 Sus scrofa ENSSSCG00000027774 I 0.815
ZFP28 Equus caballus ENSECAG00000013849 I 0.814
ENSSTOG00000022134 Ictidomys tridecemlineatus ENSSTOG00000022134 I 0.813
ENSMPUG00000006646 Mustela putorius furo ENSMPUG00000006646 I 0.812
ZFP28 Canis familiaris ENSCAFG00000024289 I 0.811
ZFP28 Dasypus novemcinctus ENSDNOG00000007010 I 0.811
ZFP28 Callithrix jacchus ENSCJAG00000020297 I 0.811
ZFP28 Loxodonta africana ENSLAFG00000010041 I 0.808
ZFP28 Ochotona princeps ENSOPRG00000014306 I 0.806
ZFP28 Echinops telfairi ENSETEG00000002303 I 0.802
ZFP28 Bos taurus ENSBTAG00000002055 N 0.794
ENSBTAP00000021794-D1 Bos grunniens ENSBTAP00000021794-D1 N 0.794
ENSPANG00000008416 Papio anubis ENSPANG00000008416 I 0.760
ENSP00000301318 Macaca fascicularis ENSP00000301318 I 0.760
ZFP28 Macaca mulatta ENSMMUG00000021673 I 0.760
ENSCSAG00000001666 Chlorocebus sabaeus ENSCSAG00000001666 I 0.760
ZFP28 Pan troglodytes ENSPTRG00000023421 I 0.758
ENSNLEG00000010865 Nomascus leucogenys ENSNLEG00000010865 I 0.758
ZFP28 Gorilla gorilla ENSGGOG00000011352 I 0.758
ENSPPYG00000010451 Pongo abelii ENSPPYG00000010451 I 0.758
ZFP28 Homo sapiens ENSG00000196867 D 0.758
ZFP28 Otolemur garnettii ENSOGAG00000004896 I 0.756