CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ADAC004531 *(Anopheles darlingi)* TEA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01285 (TEA)	IPR000818	ADAC004531	T346385_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
sd M03995_2.00	Drosophila melanogaster	HGGAATGYRN	NYRCATTCCD	SELEX Nitta et al.(2015) sd_1	0.893	0.893
sd M03996_2.00	Drosophila melanogaster	DDWGGAATGYRN	NYRCATTCCWHH	SELEX Nitta et al.(2015) sd_2	0.893	0.893
sd M06455_2.00	Drosophila melanogaster	NYBHNRWATKWH	DWMATWYNDVRN	B1H Zhu et al.(2011) sd_FlyReg_FBgn0003345	0.893	0.893
sd M07545_2.00	Drosophila melanogaster	NYBHNRWATKWH	DWMATWYNDVRN	DNaseI footprinting Mathelier et al.(2014) MA0243.1	0.893	0.893
sd M11410_2.00	Drosophila melanogaster	Transfac license required	Transfac license required	Transfac Matys et al.(2006) I$SD_Q6	0.893	0.893
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ADAC004531-PA	TEA	162	219	LDVGDMSDDEQDLSSADAEGVWSPDIEQSFQEALAIYPPCGRRKIILSEEGKMYGPSR

Links
Other TEA family TFs
Other *Anopheles darlingi* TFs