CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

BN7_6356 *(Wickerhamomyces ciferrii)* APSES
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF04383 (KilA-N)	IPR018004	BN7_6356	T011722_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
PHD1 M00006_2.00	Saccharomyces cerevisiae	GMTGCAKG	CMTGCAKC	PBM Badis et al.(2008) PHD1_4559	0.656	0.759
PHD1 M01516_2.00	Saccharomyces cerevisiae	NBMTGCANN	NNTGCAKVN	PBM Zhu et al.(2009) Phd1	0.656	0.759
PHD1 M07437_2.00	Saccharomyces cerevisiae	NSMTGCABNN	NNVTGCAKSN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0355.1	0.656	0.759
PHD1 M07547_2.00	Saccharomyces cerevisiae	VCACACCCACACMCCACACMCNNMCVCH	DGBGKNNGKGTGTGGKGTGTGGGTGTGB	ChIP-exo Rhee et al.(2011) Phd1_1	0.656	0.759
PHD1 M07548_2.00	Saccharomyces cerevisiae	MYGCRC	GYGCRK	ChIP-exo Rhee et al.(2011) Phd1_2	0.656	0.759
PHD1 M07549_2.00	Saccharomyces cerevisiae	TAGCCGCCGAR	YTCGGCGGCTA	ChIP-exo Rhee et al.(2011) Phd1_3	0.656	0.759
PHD1 M08475_2.00	Saccharomyces cerevisiae	SCNGCRGG	CCYGCNGS	Misc DeBoer et al.(2011) YKL043W_393	0.656	0.759
PHD1 M08476_2.00	Saccharomyces cerevisiae	NSMTGCABNN	NNVTGCAKSN	Misc DeBoer et al.(2011) YKL043W_554	0.656	0.759
For this family, TFs with SR scores > 0.650* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCH46757	APSES	232	323	YQVESRGISVSRREDTNFINGTKLLNVAGMTRGRRDGILKSEKVRYVVKIGAMNLKGVWIPFERALELARNEGIVDLLYPLFVKDIKELYQG

Links
Other APSES family TFs
Other *Wickerhamomyces ciferrii* TFs