CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bo6g086380 *(Brassica oleracea)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	Bo6g086380	T057324_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
bZIP911 M02661_2.00	Antirrhinum majus	GRTGACGTGKMC	GKMCACGTCAYC	SELEX Mathelier et al.(2014) MA0097.1	0.801	0.565
bZIP911 M10064_2.00	Antirrhinum majus	GRTGACGTGGCC	GGCCACGTCAYC	Transfac Matys et al.(2006) P$BZIP911_01	0.801	0.565
bZIP911 M10065_2.00	Antirrhinum majus	GRTGACGTGTAC	GTACACGTCAYC	Transfac Matys et al.(2006) P$BZIP911_02	0.801	0.565
BZIP44 M06756_2.00	Arabidopsis thaliana	DWGMTGACGTGGC	GCCACGTCAKCWH	Dap-seq OMalley et al.(2016) bZIP44_colamp_a	0.798	0.806
BZIP44 M06757_2.00	Arabidopsis thaliana	DDWGMTGACGTGGCM	KGCCACGTCAKCWHH	Dap-seq OMalley et al.(2016) bZIP44_col	0.798	0.806
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bo6g086380.1	bZIP	36	97	DERKRKRKQSNRESARRSRMRKQQHLDDLAAQVTHLRKENGHIIAGIAVTTEHYVTIEAENS

Links
Other bZIP family TFs
Other *Brassica oleracea* TFs