TF Information

AtbZIP3 *(Arabidopsis lyrata)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00170 (bZIP_1)	IPR011616	fgenesh2_kg.6__1562__AT5G15830.1	T062374_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ATBZIP42 M06775_2.00	Arabidopsis thaliana	TGCTGACGTGGM	KCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_col_a	0.871	0.806
ATBZIP42 M06776_2.00	Arabidopsis thaliana	TGCTGACGTGGCV	BGCCACGTCAGCA	Dap-seq OMalley et al.(2016) bZIP42_colamp_a	0.871	0.806
OS02G0266800 M10046_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$RITA1_01	0.790	0.468
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
fgenesh2_kg.6__1562__AT5G15830.1	bZIP	71	132	NERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDNNDRVIQENL

Links
Other bZIP family TFs
Other *Arabidopsis lyrata* TFs

Invalid Input OrderBy

144 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action