TF Information

XP_002492817.1 *(Pichia pastoris)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00046 (Homeobox)	IPR001356	XP_002492817.1	T231088_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
TOS8 M02192_2.00	Saccharomyces cerevisiae	NNNTKACGTMW	WKACGTMANNN	PBM Weirauch et al.(2014) pTH5696	0.703	0.607
TOS8 M00057_2.00	Saccharomyces cerevisiae	NNNCRYGNNN	NNNCRYGNNN	PBM Badis et al.(2008) TOS8_2100	0.703	0.607
TOS8 M07486_2.00	Saccharomyces cerevisiae	NWTGACAB	VTGTCAWN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0408.1	0.703	0.607
TOS8 M08574_2.00	Saccharomyces cerevisiae	NWTGACAB	VTGTCAWN	Misc DeBoer et al.(2011) YGL096W_494	0.703	0.607
CUP9 M00059_2.00	Saccharomyces cerevisiae	TGACABHW	WDVTGTCA	PBM Badis et al.(2008) CUP9_4508	0.701	0.625
CUP9 M01553_2.00	Saccharomyces cerevisiae	NWGACAYWWH	DWWRTGTCWN	PBM Zhu et al.(2009) Cup9	0.701	0.625
CUP9 M07488_2.00	Saccharomyces cerevisiae	TGACAYAWW	WWTRTGTCA	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0288.1	0.701	0.625
CUP9 M08576_2.00	Saccharomyces cerevisiae	TGACAYAWW	WWTRTGTCA	Misc DeBoer et al.(2011) YPL177C_480	0.701	0.625
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
XP_002492817.1	Homeodomain	172	230	KKRRSNLPKRTTTILSDWLVNNLNHPYPNPRQKLELIEQTGLTSQQLSNWFINARRRKI

Links
Other Homeodomain family TFs
Other *Pichia pastoris* TFs

Invalid Input OrderBy

171 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action