TF Information

LjSGA_138513.1.1 *(Lotus japonicus)* HSF
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00447 (HSF_DNA-bind)	IPR000232	LjSGA_138513.1.1	T243581_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HSFB4 M06936_2.00	Arabidopsis thaliana	RGAASNTTCTAGAAN	NTTCTAGAANSTTCY	Dap-seq OMalley et al.(2016) HSFB4_col_a	0.384	0.493
HSFA4A M06947_2.00	Arabidopsis thaliana	NNNRGAABBTTCTAGAANN	NNTTCTAGAAVVTTCYNNN	Dap-seq OMalley et al.(2016) HSF21_col_a	0.340	0.388
HSFB2B M06945_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_col_a	0.330	0.433
HSFB2B M06946_2.00	Arabidopsis thaliana	RGAANNTTCTAGAA	TTCTAGAANNTTCY	Dap-seq OMalley et al.(2016) HSF7_colamp_a	0.330	0.433
For this family, TFs with SR scores > 0.318* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
LjSGA_138513.1.1	HSF	16	92	FLTKTYQLVDDPATDHIVSWGEDDTTFIVWRPPEFARTSSLTTFSTTLLQLCPPHSHICINIYHIFHFHSSKSIKFS

Links
Other HSF family TFs
Other *Lotus japonicus* TFs

Invalid Input OrderBy

425 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action