TF Information

SELMODRAFT_85923 *(Selaginella moellendorffii)* Leafy
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF01698 (FLO_LFY)	IPR002910	SELMODRAFT_85923	T244744_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
LFY M02692_2.00	Arabidopsis thaliana	YWTKRACCRSYGGTYMAWR	YWTKRACCRSYGGTYMAWR	SELEX Mathelier et al.(2014) MA0590.1	0.724	0.724
LFY M10895_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$LFY_Q2	0.724	0.724
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EFJ32741	Leafy	1	116	KERGEKCPTKVTNQVFRHAKHRGASYINKPKMRHYVHCYALHCLDLEQSNHLRKVFKDRGENVGAWRQACYYPLVEMARNLNWDIEGVFSRNDKLRIWYVPTRLRQLCHLEKSKEC

Links
Other Leafy family TFs
Other *Selaginella moellendorffii* TFs

Invalid Input OrderBy

35 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action