TF Information

PRUPE_ppa001291mg *(Prunus persica)* NAC/NAM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02365 (NAM)	IPR003441	PRUPE_ppa001291mg	T295370_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
NTL9 M02371_2.00	Arabidopsis thaliana	ATTACTTAA	TTAAGTAAT	PBM Weirauch et al.(2014) pTH8207	0.919	0.842
NTL9 M11081_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBNAC_01	0.919	0.842
NTL9 M11082_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBNAC_02	0.919	0.842
For this family, TFs with SR scores > 0.870* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EMJ11570	NAC/NAM	10	144	PLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVIKSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSTGQVGMKKTLVFYRGRAPRGERTSWIMHEYRA

Links
Other NAC/NAM family TFs
Other *Prunus persica* TFs

Invalid Input OrderBy

45 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action