CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSSHAG00000000104 *(Sarcophilus harrisii)* STAT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF02864 (STAT_bind)	IPR013801	ENSSHAG00000000104	T337663_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Stat5a M09420_2.00	Mus musculus	TTCYMRGAAN	NTTCYKRGAA	Misc Kulakovskiy et al.(2013) STA5A_MOUSE.H11MO.0.A	0.959	0.959
STAT5B M09417_2.00	Homo sapiens	NNTTCYMRGAAN	NTTCYKRGAANN	Misc Kulakovskiy et al.(2013) STA5B_HUMAN.H11MO.0.A	0.918	0.918
STAT5B M11371_2.00	Homo sapiens	NDWTTCYNGGAAWHN	NDWTTCCNRGAAWHN	Transfac Matys et al.(2006) V$STAT5B_01	0.918	0.918
Stat5b M09421_2.00	Mus musculus	NNTTCYMRGAAN	NTTCYKRGAANN	Misc Kulakovskiy et al.(2013) STA5B_MOUSE.H11MO.0.A	0.908	0.908
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSSHAP00000000119	STAT	1	100	MNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSIGGNELVFQVKKRP

Links
Other STAT family TFs
Other *Sarcophilus harrisii* TFs