CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSPSIG00000017440 *(Pelodiscus sinensis)* THAP finger
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF05485 (THAP)	IPR006612	ENSPSIG00000017440	T348656_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
THAP1 M08176_2.00	Homo sapiens	DNHKGGMRR	YYKCCMDNH	ChIP-seq Mathelier et al.(2014) MA0597.1	0.930	0.930
THAP1 M08020_2.00	Homo sapiens	SGCCATBTTKRNWVHGGGCRR	YYGCCCDBWNYMAAVATGGCS	ChIP-seq Gerstein et al.(2012) K562_THAP1_HudsonAlpha	0.930	0.930
THAP1 M09439_2.00	Homo sapiens	GCCCDVVNBVRVSVKGGCBSCB	VGSVGCCMBSBYBVNBBHGGGC	Misc Kulakovskiy et al.(2013) THAP1_HUMAN.H11MO.0.C	0.930	0.930
THAP1 M11412_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$THAP1_01	0.930	0.930
THAP1 M11413_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$THAP1_02	0.930	0.930
THAP1 M11414_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$THAP1_04	0.930	0.930
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSPSIP00000019655	THAP finger	1	60	RFPLTRPDLCKKWEAAVKRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFCY

Links
Other THAP finger family TFs
Other *Pelodiscus sinensis* TFs