CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ENSECAG00000011356 *(Equus caballus)* CSD
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00313 (CSD)	IPR002059	ENSECAG00000011356	T164529_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
YBX1 M04661_2.00	Homo sapiens	GRTGGWACR	YGTWCCAYC	SELEX Yin et al.(2017) YBX1_eDBD_HT-SELEX	0.985	0.985
YBX1 M10411_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$YB1_Q3	0.985	0.985
YBX1 M10412_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$YB1_Q4	0.985	0.985
YBX1 M04662_2.00	Homo sapiens	GRTGKDRCD	HGYHMCAYC	SELEX Yin et al.(2017) YBX1_eDBD_Methyl-HT-SELEX	0.985	0.985
NEMVEDRAFT_v1g104083 M01207_2.00	Nematostella vectensis	NNNDDHRN	NYDHHNNN	PBM Lambert et al.(2019) pTH9768	0.803	0.803
cey-1 M01903_2.00	Caenorhabditis elegans	NNNGRTRDD	HHYAYCNNN	PBM Weirauch et al.(2014) pTH8991	0.758	0.758
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSECAP00000009163	CSD	11	80	VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLHSVGDGETVEFDVVEGEKGAEAANVTGP

Links
Other CSD family TFs
Other *Equus caballus* TFs