CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Carubv10012703m.g *(Capsella rubella)* FAR1
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF03101 (FAR1)	IPR004330	Carubv10012703m.g	T181270_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
FAR1 M06880_2.00	Arabidopsis thaliana	NNYHCACGCGCYDNH	DNHRGCGCGTGDRNN	Dap-seq OMalley et al.(2016) FAR1_col_a	0.933	0.933
FAR1 M06881_2.00	Arabidopsis thaliana	NNNNBDNDNNYHCACGCGCYD	HRGCGCGTGDRNNHNHVNNNN	Dap-seq OMalley et al.(2016) FAR1_colamp_a	0.933	0.933
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Carubv10012703m	FAR1	65	153	LFYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGVTPESESGSSSRRSSVKKTDCKASMHVKRRADGKWIIHEFIKDHNHELLP

Links
Other FAR1 family TFs
Other *Capsella rubella* TFs