CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

scaffold_101953.1 *(Arabidopsis lyrata)* Myb/SANT
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00249 (Myb_DNA-binding)	IPR014778	scaffold_101953.1	T279366_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AT1G72740 M07033_2.00	Arabidopsis thaliana	HMNAAACCCTAAWYY	RRWTTAGGGTTTNKD	Dap-seq OMalley et al.(2016) AT1G72740_col_a	0.876	0.936
AT1G72740 M07034_2.00	Arabidopsis thaliana	HNWAACCCTAAHYHNNNHNNN	NNNDNNNDRDTTAGGGTTWND	Dap-seq OMalley et al.(2016) AT1G72740_colamp_a	0.876	0.936
OS01G0708000 M02326_2.00	Oryza sativa	WRMCCTAVNN	NNBTAGGKYW	PBM Weirauch et al.(2014) pTH8716	0.837	0.809
TRB1 M01070_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Sullivan et al.(2014) pTH7117	0.750	0.723
PK06103.1 M02348_2.00	Cannabis sativa	TGCCCTAG	CTAGGGCA	PBM Weirauch et al.(2014) pTH9649	0.695	0.745
TRB2 M02314_2.00	Arabidopsis thaliana	WRMCCTAR	YTAGGKYW	PBM Weirauch et al.(2014) pTH7094	0.662	0.723
TRB2 M01083_2.00	Arabidopsis thaliana	HRMCCTAR	YTAGGKYD	PBM Sullivan et al.(2014) pTH7260	0.662	0.723
TRB2 M07157_2.00	Arabidopsis thaliana	HHHHHNWWRCCCTAAWHHN	NDDWTTAGGGYWWNDDDDD	Dap-seq OMalley et al.(2016) TBP3_col_a	0.662	0.723
TRB2 M07158_2.00	Arabidopsis thaliana	HVDHHHNWARCCCTAAHYH	DRDTTAGGGYTWNDDDHBD	Dap-seq OMalley et al.(2016) TBP3_colamp_a	0.662	0.723
For this family, TFs with SR scores > 0.661* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
scaffold_101953.1	Myb	5	57	KLKWTAEEEEALLAGVGKHGPGKWKNILRDPEFAEQLSSRSNIDLKDKWRNLS

Links
Other Myb/SANT family TFs
Other *Arabidopsis lyrata* TFs

213 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
F775_02798	Aegilops tauschii	F775_02798	N
F775_23176	Aegilops tauschii	F775_23176	N
F775_33202	Aegilops tauschii	F775_33202	N
TRIUR3_22433	Triticum urartu	TRIUR3_22433	N