CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Bra030919 *(Brassica rapa)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Bra030919	T001204_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
EREBP1 M09708_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$EREBP1_01	0.734	0.850
RAP2-2 M00719_2.00	Arabidopsis thaliana	NNRBYGNN	NNCRVYNN	PBM Chang et al.(2013) pTH7227	0.732	0.900
RAP2-12 M01046_2.00	Arabidopsis thaliana	RSMGBMNNNN	NNNNKVCKSY	PBM Sullivan et al.(2014) pTH7359	0.728	0.900
RAP2-12 M06588_2.00	Arabidopsis thaliana	NHDCCGCCGCCRHHDHNNNHN	NDNNNDHDDYGGCGGCGGHDN	Dap-seq OMalley et al.(2016) RAP212_col_a	0.728	0.900
Q7Y1W2_TOBAC M09735_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CEF1_01	0.723	0.850
Q2TN80_WHEAT M09715_2.00	Triticum aestivum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ERF1_02	0.698	0.825
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra030919.1-P	AP2	104	144	SQYRGIRQRPWGKWAAEIRDPREAEEAARAYDAAARRIRGS

Links
Other AP2 family TFs
Other *Brassica rapa* TFs