CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

LPERR08G04370 *(Leersia perrieri)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	LPERR08G04370	T002638_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Q84J59_MAIZE M09717_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BD1_01	0.726	0.667
ERF086 M06663_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYHD	HDRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) PUCHI_col_a	0.722	0.667
ERF086 M06664_2.00	Arabidopsis thaliana	NNNNHDHCKCCGCCGYHDHHDHNNN	NNNDHDDHDRCGGCGGMGDHDNNNN	Dap-seq OMalley et al.(2016) PUCHI_colamp_a	0.722	0.667
ERF087 M06573_2.00	Arabidopsis thaliana	HHDYCKCCGCCGYYD	HRRCGGCGGMGRHDD	Dap-seq OMalley et al.(2016) AT1G28160_col_a	0.719	0.686
ERF087 M06574_2.00	Arabidopsis thaliana	HDYCKCCGCCGYCR	YGRCGGCGGMGRHD	Dap-seq OMalley et al.(2016) AT1G28160_colamp_a	0.719	0.686
LEP M06661_2.00	Arabidopsis thaliana	NBCKCCGCCGYHDHHDYHNHH	DDNDRHDDHDRCGGCGGMGVN	Dap-seq OMalley et al.(2016) LEP_col_a	0.716	0.686
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
LPERR08G04370.1	AP2	29	80	SEYLGVRRRPWGKYAAEIRNPYTKERHWLGTFDTAEEAAVAYDLSAISISGK

Links
Other AP2 family TFs
Other *Leersia perrieri* TFs