CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

RO3G_13161 *(Rhizopus oryzae)* Forkhead
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00250 (Forkhead)	IPR001766	RO3G_13161	T184397_2.00	Broad (2016-May-1)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HCM1 M00044_2.00	Saccharomyces cerevisiae	NRWHAACAN	NTGTTDWYN	PBM Badis et al.(2008) HCM1_2157	0.720	0.581
HCM1 M07473_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0317.1	0.720	0.581
HCM1 M08554_2.00	Saccharomyces cerevisiae	VWMAACAH	DTGTTKWB	Misc DeBoer et al.(2011) YCR065W_570	0.720	0.581
NCU06173 M01992_2.00	Neurospora crassa	RTAAACAH	DTGTTTAY	PBM Weirauch et al.(2014) pTH8896	0.685	0.558
For this family, TFs with SR scores > 0.664* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
RO3T_13160	Forkhead	69	161	KPPYSYATLIAHAILTSQEGRLTLNDIYLWISDHYKAYSIGVGGWQNSIRHNLSLNKKWFQRIERKRTQASTGKGSFWTLVPGAEQVFLENLT

Links
Other Forkhead family TFs
Other *Rhizopus oryzae* TFs