CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

NCAS_0C04570 *(Naumovozyma castellii)* GATA
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00320 (GATA)	IPR000679	NCAS_0C04570	T194268_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
GAT3 M00053_2.00	Saccharomyces cerevisiae	NDAGWTYNNN	NNNRAWCTHN	PBM Badis et al.(2008) GAT3_2122	0.805	0.528
GAT3 M01549_2.00	Saccharomyces cerevisiae	NDAGWTYNNN	NNNRAWCTHN	PBM Zhu et al.(2009) Gat3	0.805	0.528
GAT3 M07482_2.00	Saccharomyces cerevisiae	RGATCYVNN	NNBRGATCY	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0301.1	0.805	0.528
GAT3 M08565_2.00	Saccharomyces cerevisiae	RGATCYVNN	NNBRGATCY	Misc DeBoer et al.(2011) YLR013W_542	0.805	0.528
For this family, TFs with SR scores > 0.802* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCC69447	GATA	85	120	CRQCSSSEIGQWRRGPYGPHTLCNKCGLFYSKVTKR

Links
Other GATA family TFs
Other *Naumovozyma castellii* TFs