CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Thhalv10027405m.g *(Eutrema salsugineum)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Thhalv10027405m.g	T009998_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.804	0.960
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.804	0.960
DREB1A M01624_2.00	Arabidopsis thaliana	NRCCGACNNN	NNNGTCGGYN	PBM Weirauch et al.(2014) pTH8163	0.800	0.940
DREB1A M01625_2.00	Arabidopsis thaliana	NNRCCGACNW	WNGTCGGYNN	PBM Weirauch et al.(2014) pTH9718	0.800	0.940
DREB1A M06641_2.00	Arabidopsis thaliana	HNYBRCCGACDWNN	NNWHGTCGGYVRND	Dap-seq OMalley et al.(2016) CBF3_col_a	0.800	0.940
DREB1A M06642_2.00	Arabidopsis thaliana	YBRCCGACATN	NATGTCGGYVR	Dap-seq OMalley et al.(2016) CBF3_colamp_a	0.800	0.940
DREB1C M01623_2.00	Arabidopsis thaliana	RCCGACAT	ATGTCGGY	PBM Weirauch et al.(2014) pTH8187	0.778	0.920
DREB1C M06639_2.00	Arabidopsis thaliana	NNNHBRCCGACATNN	NNATGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF2_col_a	0.778	0.920
DREB1C M06640_2.00	Arabidopsis thaliana	NYBRCCGACATVN	NBATGTCGGYVRN	Dap-seq OMalley et al.(2016) CBF2_colamp_a	0.778	0.920
DREB1G M01635_2.00	Oryza sativa	NYGCCGACAN	NTGTCGGCRN	PBM Weirauch et al.(2014) pTH8352	0.736	0.800
DREB1G M09707_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1G_01	0.736	0.800
DREB1F M00962_2.00	Arabidopsis thaliana	NRCCGACNN	NNGTCGGYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_thaliana	0.723	0.760
DREB1F M00840_2.00	Arabidopsis thaliana	NRYCGACNN	NNGTCGRYN	PBM Franco-Zorrilla et al.(2014) DDF1	0.723	0.760
DDF1 M00964_2.00	Arabidopsis lyrata	NRYCGACDY	RHGTCGRYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_lyrata	0.723	0.760
DREB1F M06564_2.00	Arabidopsis thaliana	NHNHYGYCGACATNN	NNATGTCGRCRDNDN	Dap-seq OMalley et al.(2016) DDF1_col_a	0.723	0.760
DREB1F M06565_2.00	Arabidopsis thaliana	HNDNNRYCGACAH	DTGTCGRYNNHND	Dap-seq OMalley et al.(2016) DDF1_colamp_a	0.723	0.760
DREB1F M09701_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1F_03	0.723	0.760
Q8S2T3_BRANA M09745_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$CBF16_01	0.705	0.900
Q6T3U0_BRANA M09743_2.00	Brassica napus	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREBII1_01	0.705	0.900
ddf2 M00965_2.00	Arabidopsis lyrata	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_lyrata	0.700	0.760
DREB1E M09709_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1E_01	0.690	0.800
DREB1B M06643_2.00	Arabidopsis thaliana	DHBRCCGACRHN	NDYGTCGGYVDH	Dap-seq OMalley et al.(2016) CBF1_col_a	0.679	0.900
DREB1B M06644_2.00	Arabidopsis thaliana	NNNHBRCCGACAWNN	NNWTGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF1_colamp_a	0.679	0.900
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Thhalv10027405m	AP2	49	100	PIYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAIALRGR

Links
Other AP2 family TFs
Other *Eutrema salsugineum* TFs

219 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
BXY_0200500	Bursaphelenchus xylophilus	BXY_0200500	N
PTRK_0000573200	Parastrongyloides trichosuri	PTRK_0000573200	N
PTRK_0001282000	Parastrongyloides trichosuri	PTRK_0001282000	N
PTRK_0001404900	Parastrongyloides trichosuri	PTRK_0001404900	N
SPAL_0000505500	Strongyloides papillosus	SPAL_0000505500	N
SSTP_0000649000	Strongyloides stercoralis	SSTP_0000649000	N
SSTP_0001179200	Strongyloides stercoralis	SSTP_0001179200	N
SVE_0249400	Strongyloides venezuelensis	SVE_0249400	N
SVE_1003800	Strongyloides venezuelensis	SVE_1003800	N

Thhalv10027405m.g (Eutrema salsugineum) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

219 Related TFs

Thhalv10027405m.g **(Eutrema salsugineum)
AP2**