CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

SVE_1703300 *(Strongyloides venezuelensis)* DM
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00751 (DM)	IPR001275	SVE_1703300	T170064_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
dmd-3 M00658_2.00	Caenorhabditis elegans	NNWGTWDN	NHWACWNN	PBM Narasimhan et al.(2015) pTH10638	0.924	0.723
Bm2567 M01923_2.00	Brugia malayi	NNNWGTTKHN	NDMAACWNNN	PBM Weirauch et al.(2014) pTH9246	0.909	0.723
WUBG_11979 M01922_2.00	Wuchereria bancrofti	ATGTWTCA	TGAWACAT	PBM Weirauch et al.(2014) pTH9296	0.906	0.723
CBG09413 M01924_2.00	Caenorhabditis briggsae	AATGTTTC	GAAACATT	PBM Weirauch et al.(2014) pTH8330	0.883	0.681
CBN06605 M01925_2.00	Caenorhabditis brenneri	NWGTWKN	NMWACWN	PBM Weirauch et al.(2014) pTH9247	0.879	0.681
CJA05633_CONSTRUCT M01936_2.00	PBM CONSTRUCTS	NWGTWDN	NHWACWN	PBM Weirauch et al.(2014) pTH9344	0.879	0.681
dmd-10 M00657_2.00	Caenorhabditis elegans	AWTGTTTC	GAAACAWT	PBM Narasimhan et al.(2015) pTH9142	0.877	0.681
For this family, TFs with SR scores > 0.845* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
SVE_1703300.1	DM	37	83	RLPHCQRCAQHGLQSRLKGHKKLCPYRNCDCVKCQVVVERQRLMADQ

Links
Other DM family TFs
Other *Strongyloides venezuelensis* TFs