CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Eucgr.I00422 *(Eucalyptus grandis)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Eucgr.I00422	T008213_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.859	0.960
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.843	0.940
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.843	0.940
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.723	0.880
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.723	0.880
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.691	0.660
ERF054 M06647_2.00	Arabidopsis thaliana	NNNNNNNNNHHDSCRCCGHC	GDCGGYGSHDDNNNNNNNNN	Dap-seq OMalley et al.(2016) At4g28140_col_a	0.679	0.800
ERF054 M06648_2.00	Arabidopsis thaliana	NNNNHDBCRCCGHCM	KGDCGGYGVHDNNNN	Dap-seq OMalley et al.(2016) At4g28140_colamp_a	0.679	0.800
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Eucgr.I00422.1	AP2	149	200	KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDEAAYKLRGD

Links
Other AP2 family TFs
Other *Eucalyptus grandis* TFs

463 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
ANAC040	Arabidopsis lyrata	fgenesh2_kg.4__689__AT2G27300.1	I
NTL8	Arabidopsis thaliana	AT2G27300	D
Bostr.28794s0029	Boechera stricta	Bostr.28794s0029	I
Bra012024	Brassica rapa	Bra012024	I
Cagra.3125s0012	Capsella grandiflora	Cagra.3125s0012	I
Carubv10023568m.g	Capsella rubella	Carubv10023568m.g	I
Thhalv10002027m.g	Eutrema salsugineum	Thhalv10002027m.g	I
Thhalv10002040m.g	Eutrema salsugineum	Thhalv10002040m.g	I
Thhalv10002300m.g	Eutrema salsugineum	Thhalv10002300m.g	I