CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Gorai.010G043200 *(Gossypium raimondii)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	Gorai.010G043200	T008667_2.00	JGI:Phytozome (2018-Apr-12)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RAP2-4 M01612_2.00	Arabidopsis thaliana	NRCCGHCMNN	NNKGDCGGYN	PBM Weirauch et al.(2014) pTH8092	0.867	0.980
ERF055 M06577_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_col_a	0.848	0.940
ERF055 M06578_2.00	Arabidopsis thaliana	NHDYCACCGHCMHH	DDKGDCGGTGRHDN	Dap-seq OMalley et al.(2016) At1g36060_colamp_a	0.848	0.940
AT5G65130 M06686_2.00	Arabidopsis thaliana	YCDYCDCCRCCGCCN	NGGCGGYGGHGRHGR	Dap-seq OMalley et al.(2016) At5g65130_col_a	0.721	0.880
AT5G65130 M06687_2.00	Arabidopsis thaliana	NNNNHNNHDSCRCCGMCMW	WKGKCGGYGSHDNNDNNNN	Dap-seq OMalley et al.(2016) At5g65130_colamp_a	0.721	0.880
ERF054 M06647_2.00	Arabidopsis thaliana	NNNNNNNNNHHDSCRCCGHC	GDCGGYGSHDDNNNNNNNNN	Dap-seq OMalley et al.(2016) At4g28140_col_a	0.684	0.800
ERF054 M06648_2.00	Arabidopsis thaliana	NNNNHDBCRCCGHCM	KGDCGGYGVHDNNNN	Dap-seq OMalley et al.(2016) At4g28140_colamp_a	0.684	0.800
WIN1 M01603_2.00	Arabidopsis thaliana	VCRCCGCNNN	NNNGCGGYGB	PBM Weirauch et al.(2014) pTH7566	0.683	0.640
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Gorai.010G043200.1	AP2	163	214	KLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFDTAEEAALAYDKAAYKLRGD

Links
Other AP2 family TFs
Other *Gossypium raimondii* TFs

457 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
GF12780	Drosophila ananassae	FBgn0089814	I	0.000
GG24145	Drosophila erecta	FBgn0116278	I	0.000
GH21767	Drosophila grimshawi	FBgn0129228	I	0.000
gem	Drosophila melanogaster	FBgn0050011	D	0.000
GI19314	Drosophila mojavensis	FBgn0142052	I	0.000
GL11578	Drosophila persimilis	FBgn0149187	I	0.000
GA24777	Drosophila pseudoobscura	FBgn0246163	I	0.000
GM21189	Drosophila sechellia	FBgn0176070	I	0.000
GD10717	Drosophila simulans	FBgn0182481	I	0.000
GJ22192	Drosophila virilis	FBgn0209305	I	0.000
GK10687	Drosophila willistoni	FBgn0212700	I	0.000
GE19341	Drosophila yakuba	FBgn0236687	I	0.000
LCUP002159	Lucilia cuprina	LCUP002159	N	0.000
MDOA006741	Musca domestica	MDOA006741	I	0.000