CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

1691_Multiple *(Saccharomyces mikatae)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00010 (HLH)	IPR001092	1691_Multiple	T051977_2.00	Superfamily (2010-Oct-26)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RTG3 M01518_2.00	Saccharomyces cerevisiae	NKCACGTGANNN	NNNTCACGTGMN	PBM Zhu et al.(2009) Rtg3	0.914	1.000
RTG3 M08480_2.00	Saccharomyces cerevisiae	NRTSACTCDYN	NRHGAGTSAYN	Misc DeBoer et al.(2011) YBL103C_1445	0.914	1.000
RTG3 M08481_2.00	Saccharomyces cerevisiae	NGTGACCS	SGGTCACN	Misc DeBoer et al.(2011) YBL103C_1446	0.914	1.000
RTG3 M08482_2.00	Saccharomyces cerevisiae	NNVNDDKCACGTGMNBDNHH	DDNHVNKCACGTGMHHNBNN	Misc DeBoer et al.(2011) YBL103C_870	0.914	1.000
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
1691_Multiple	bHLH	286	345	KREFHNAVERRRRELIKQKIKELGQLVPPSLLNYDDLGKQIKPNKGIILDRTVEYLQYLA

Links
Other bHLH family TFs
Other *Saccharomyces mikatae* TFs