CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

Ca_08103 *(Cicer arietinum)* bZIP
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00170 (bZIP_1)	IPR011616	Ca_08103	T069929_2.00	GigaDB (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
BZIP17 M01778_2.00	Arabidopsis thaliana	NNHBACGYRN	NYRCGTVDNN	PBM Weirauch et al.(2014) pTH7221	0.892	0.844
TGA1B_TOBAC M10083_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_01	0.835	0.734
TGA1B_TOBAC M10084_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$TGA1B_Q2	0.835	0.734
For this family, TFs with SR scores > 0.782* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Ca_08103	bZIP	276	339	DEDEKRKARLMRNRESAQLSRQRKKHYVEELEEKVRSMHSTIADLSSKITFVMAENATLRQQLG

Links
Other bZIP family TFs
Other *Cicer arietinum* TFs