CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

GH19308 *(Drosophila grimshawi)* Homeodomain
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00046 (Homeobox)	IPR001356	FBgn0126773	T217795_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
HHEX M06541_2.00	Drosophila melanogaster	WYBAATWA	TWATTVRW	B1H Mathelier et al.(2014) MA0183.1	0.866	0.965
HHEX M06358_2.00	Drosophila melanogaster	WYBAATWA	TWATTVRW	B1H Zhu et al.(2011) CG7056_Cell_FBgn0038852	0.866	0.965
HHEX M06359_2.00	Drosophila melanogaster	NYBAATWR	YWATTVRN	B1H Zhu et al.(2011) CG7056_SOLEXA_FBgn0038852	0.866	0.965
pha-2 M02184_2.00	Caenorhabditis elegans	NNNATNDNNN	NNNHNATNNN	PBM Weirauch et al.(2014) pTH6423	0.826	0.719
For this family, TFs with SR scores > 0.599* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
FBpp0153214	Homeodomain	186	242	KGGQIRFTSQQTKNLENRFSSSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRR

Links
Other Homeodomain family TFs
Other *Drosophila grimshawi* TFs