CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

KAFR_0B01450 *(Kazachstania africana)* Zinc cluster
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00172 (Zn_clus)	IPR001138	KAFR_0B01450	T371652_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
RGT1 M00092_2.00	Saccharomyces cerevisiae	CGGRDNWWHN	NDWWNHYCCG	PBM Badis et al.(2008) RGT1_2131	0.557	0.750
RGT1 M01585_2.00	Saccharomyces cerevisiae	HCGGADNWWN	NWWNHTCCGD	PBM Zhu et al.(2009) Rgt1	0.557	0.750
RGT1 M07518_2.00	Saccharomyces cerevisiae	NCGGADNAWHN	NDWTNHTCCGN	PBM, CSA and or DIP-chip Mathelier et al.(2014) MA0367.1	0.557	0.750
RGT1 M08673_2.00	Saccharomyces cerevisiae	NDNNNYCGGAWWAAYHNNNN	NNNNDRTTWWTCCGRNNNHN	Misc DeBoer et al.(2011) YKL038W_803	0.557	0.750
RGT1 M11480_2.00	Saccharomyces cerevisiae	Transfac license required	Transfac license required	Transfac Matys et al.(2006) F$RGT1_Q5	0.557	0.750
For this family, TFs with SR scores > 0.537* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
CCF56444	Zinc cluster	61	102	RACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRG

Links
Other Zinc cluster family TFs
Other *Kazachstania africana* TFs