TF Information

Bra001386 *(Brassica rapa)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	Bra001386	T000986_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
DREB2A M06655_2.00	Arabidopsis thaliana	NNNNHDHMACCGMCWYHNNNN	NNNNDRWGKCGGTKDHDNNNN	Dap-seq OMalley et al.(2016) DREB2_col_a	0.731	0.840
DREB2A M06656_2.00	Arabidopsis thaliana	NHNHMACCGMCWTWD	HWAWGKCGGTKDNDN	Dap-seq OMalley et al.(2016) DREB2_colamp_a	0.731	0.840
Q1ESI9_MAIZE M09714_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB2A_02	0.677	0.820
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Bra001386.1-P	AP2	70	121	CSFRGVRQRVWGKWVAEIREPNRVSRLWLGTFPTAEEAACAYDEAAKVMYGS

Links
Other AP2 family TFs
Other *Brassica rapa* TFs

Invalid Input OrderBy

30 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action