TF Information

Ahr *(Mus musculus)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ENSMUSG00000019256	T035669_2.00	Ensembl (2018-Dec-8)	Link out
NCBI Gene Info: The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Ahr M08747_2.00	Mus musculus	DCACGCNMH	DKNGCGTGH	Misc Kulakovskiy et al.(2013) AHR_MOUSE.H11MO.0.B	(Direct)	(Direct)
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AHR M08716_2.00	Homo sapiens	DCACGCNMH	DKNGCGTGH	Misc Kulakovskiy et al.(2013) AHR_HUMAN.H11MO.0.B	0.914	1.000
AHR M09816_2.00	Homo sapiens	WSTCACGCDASYYBGRRS	SYYCVRRSTHGCGTGASW	Transfac Matys et al.(2006) V$AHR_01	0.914	1.000
AHR M09817_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q5	0.914	1.000
AHR M09818_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q6_01	0.914	0.979
AHR M09819_2.00	Homo sapiens	Transfac license required	Transfac license required	Transfac Matys et al.(2006) V$AHR_Q6	0.914	0.979
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ENSMUSP00000106434	bHLH	33	79	NPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK
ENSMUSP00000112137	bHLH	34	79	PSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK

Links
Other bHLH family TFs
Other *Mus musculus* TFs

Invalid Input OrderBy

57 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action