ZFP28 (Homo sapiens)
C2H2 ZF

TF Information

Pfam ID Interpro ID Gene ID CIS-BP ID Sequence source Animal TF db
PF00096 (zf-C2H2) IPR007087 ENSG00000196867 T095321_2.00 Ensembl (2018-Dec-8) Link out

Directly determined binding motifs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
ZFP28
M08378_2.00
Homo sapiens
DNNHNNHNHDDBMKYTCHDTTTCYTYWDNK

NAYMNHWRARGAAAHDGARMKVHHDNDNND
ChIP-seq
Schmitges et al.(2016)
Q8NHY6_2-12.RCADE
(Direct) (Direct)
ZFP28
M08949_2.00
Homo sapiens
YTCTRTTTCTTCTKRWGTCA

TGACWYMAGAAGAAAYAGAR
Misc
Kulakovskiy et al.(2013)
ZFP28_HUMAN.H11MO.0.C
(Direct) (Direct)

Motifs from related TFs

Name/Motif ID Species Forward Reverse Type/Study/Study ID SR
Score
DBD
Identity
For this family, TFs with SR scores > 0.755 will likely have a similar motif

DNA Binding Domains

Protein ID Domain From To Sequence
ENSP00000301318 C2H2 ZF 420 442
ENSP00000301318 C2H2 ZF 448 470
ENSP00000301318 C2H2 ZF 476 499
ENSP00000301318 C2H2 ZF 505 527
ENSP00000301318 C2H2 ZF 533 555
ENSP00000301318 C2H2 ZF 561 583
ENSP00000301318 C2H2 ZF 589 611
ENSP00000301318 C2H2 ZF 617 639
ENSP00000301318 C2H2 ZF 645 667
ENSP00000301318 C2H2 ZF 673 695
ENSP00000301318 C2H2 ZF 701 723
ENSP00000301318 C2H2 ZF 729 751
ENSP00000301318 C2H2 ZF 757 779
ENSP00000301318 C2H2 ZF 785 807
ENSP00000301318 C2H2 ZF 819 835

Links

Other C2H2 ZF family TFs
Other Homo sapiens TFs

20 Related TFs

Name Species Gene ID Motif Evidence SR
Score
Action
AAB25676 Xenopus laevis AAB25676 I 0.000
AAEL003504 Aedes aegypti AAEL003504 I 0.000
AAEL003506 Aedes aegypti AAEL003506 I 0.000
AAEL004130 Aedes aegypti AAEL004130 I 0.000
AAEL014277 Aedes aegypti AAEL014277 I 0.000
AAEL014635 Aedes aegypti AAEL014635 I 0.000
AALB002054 Anopheles albimanus AALB002054 I 0.000
Aan_R000875 Calypte anna Aan_R000875 I 0.000
Aan_R001085 Calypte anna Aan_R001085 I 0.000
Aan_R004615 Calypte anna Aan_R004615 I 0.000
AARA002011 Anopheles arabiensis AARA002011 I 0.000
AARA002059 Anopheles arabiensis AARA002059 I 0.000
AARA002062 Anopheles arabiensis AARA002062 I 0.000
AARA004892 Anopheles arabiensis AARA004892 I 0.000
AARA005104 Anopheles arabiensis AARA005104 I 0.000
AARA005105 Anopheles arabiensis AARA005105 I 0.000
AARA006634 Anopheles arabiensis AARA006634 I 0.000
AATE000441 Anopheles atroparvus AATE000441 I 0.000
AATE004862 Anopheles atroparvus AATE004862 I 0.000
AATE010544 Anopheles atroparvus AATE010544 I 0.000
AATE013322 Anopheles atroparvus AATE013322 I 0.000
AATE018514 Anopheles atroparvus AATE018514 I 0.000
AATE020015 Anopheles atroparvus AATE020015 I 0.000
ACAC_0000008801 Angiostrongylus cantonensis ACAC_0000008801 I 0.000
ACAC_0000394201 Angiostrongylus cantonensis ACAC_0000394201 I 0.000
ACAC_0000782501 Angiostrongylus cantonensis ACAC_0000782501 I 0.000
ACEP18657 Atta cephalotes ACEP18657 I 0.000
ACEP22979 Atta cephalotes ACEP22979 I 0.000
ACEP24978 Atta cephalotes ACEP24978 I 0.000
ACEP27486 Atta cephalotes ACEP27486 I 0.000
ACEP27487 Atta cephalotes ACEP27487 I 0.000
ACHR002772 Anopheles christyi ACHR002772 I 0.000
ACHR003783 Anopheles christyi ACHR003783 I 0.000
ACHR005287 Anopheles christyi ACHR005287 I 0.000
ACHR005498 Anopheles christyi ACHR005498 I 0.000
ACHR005776 Anopheles christyi ACHR005776 I 0.000
ACHR010176 Anopheles christyi ACHR010176 N 0.000
ACOC_0000611701 Angiostrongylus costaricensis ACOC_0000611701 I 0.000
ACOM028612 Anopheles coluzzii ACOM028612 I 0.000
ACOM030638 Anopheles coluzzii ACOM030638 I 0.000
ACOM030639 Anopheles coluzzii ACOM030639 I 0.000
ACOM034313 Anopheles coluzzii ACOM034313 I 0.000
ACOM034371 Anopheles coluzzii ACOM034371 I 0.000
ACOM034376 Anopheles coluzzii ACOM034376 I 0.000
ACUA003169 Anopheles culicifacies ACUA003169 I 0.000
ACUA004275 Anopheles culicifacies ACUA004275 I 0.000
ACUA016950 Anopheles culicifacies ACUA016950 I 0.000
ACUA023917 Anopheles culicifacies ACUA023917 I 0.000
ACUA027899 Anopheles culicifacies ACUA027899 I 0.000
ACUA028387 Anopheles culicifacies ACUA028387 I 0.000
ACYPI002874 Acyrthosiphon pisum ACYPI002874 I 0.000
ACYPI006661 Acyrthosiphon pisum ACYPI006661 I 0.000
ACYPI087925 Acyrthosiphon pisum ACYPI087925 I 0.000
ACYPI36146 Acyrthosiphon pisum ACYPI36146 I 0.000
ACYPI43755 Acyrthosiphon pisum ACYPI43755 I 0.000
ADAC002743 Anopheles darlingi ADAC002743 I 0.000
ADAC002744 Anopheles darlingi ADAC002744 I 0.000
ADAC003437 Anopheles darlingi ADAC003437 I 0.000
ADIR003024 Anopheles dirus ADIR003024 I 0.000
ADIR009081 Anopheles dirus ADIR009081 I 0.000
ADIR010481 Anopheles dirus ADIR010481 I 0.000
ADIR010484 Anopheles dirus ADIR010484 I 0.000
ADIR011039 Anopheles dirus ADIR011039 I 0.000
ADIR011040 Anopheles dirus ADIR011040 I 0.000
AEPI001923 Anopheles epiroticus AEPI001923 I 0.000
AEPI001924 Anopheles epiroticus AEPI001924 I 0.000
AEPI006095 Anopheles epiroticus AEPI006095 I 0.000
AEPI006098 Anopheles epiroticus AEPI006098 I 0.000
AEPI006141 Anopheles epiroticus AEPI006141 I 0.000
AEPI009868 Anopheles epiroticus AEPI009868 I 0.000
AFAF002437 Anopheles farauti AFAF002437 I 0.000
AFAF002812 Anopheles farauti AFAF002812 I 0.000
AFAF002845 Anopheles farauti AFAF002845 I 0.000
AFAF003232 Anopheles farauti AFAF003232 I 0.000
AFAF015687 Anopheles farauti AFAF015687 I 0.000
AFAF017171 Anopheles farauti AFAF017171 I 0.000
Afo_R001648 Aptenodytes forsteri Afo_R001648 I 0.000
Afo_R002824 Aptenodytes forsteri Afo_R002824 I 0.000
Afo_R003423 Aptenodytes forsteri Afo_R003423 I 0.000
Afo_R006601 Aptenodytes forsteri Afo_R006601 I 0.000
Afo_R006935 Aptenodytes forsteri Afo_R006935 I 0.000
Afo_R008229 Aptenodytes forsteri Afo_R008229 I 0.000
AFUN001180 Anopheles funestus AFUN001180 I 0.000
AFUN001615 Anopheles funestus AFUN001615 I 0.000
AFUN003774 Anopheles funestus AFUN003774 I 0.000
AFUN003775 Anopheles funestus AFUN003775 I 0.000
AFUN004488 Anopheles funestus AFUN004488 I 0.000
AGAP001560 Anopheles gambiae AGAP001560 I 0.000
AGAP001618 Anopheles gambiae AGAP001618 I 0.000
AGAP001619 Anopheles gambiae AGAP001619 I 0.000
AGAP003574 Anopheles gambiae AGAP003574 I 0.000
AGAP004647 Anopheles gambiae AGAP004647 I 0.000
en Anopheles gambiae AGAP008023 I 0.000
AGAP008025 Anopheles gambiae AGAP008025 I 0.000
Alligator_sinensis_CCG003367.1 Alligator sinensis Alligator_sinensis_CCG003367.1 I 0.000
Alligator_sinensis_CCG003906.1 Alligator sinensis Alligator_sinensis_CCG003906.1 I 0.000
Alligator_sinensis_CCG007467.1 Alligator sinensis Alligator_sinensis_CCG007467.1 I 0.000
Alligator_sinensis_CCG010193.1 Alligator sinensis Alligator_sinensis_CCG010193.1 I 0.000
Alligator_sinensis_CCG014469.1 Alligator sinensis Alligator_sinensis_CCG014469.1 I 0.000
Alligator_sinensis_CCG014612.1 Alligator sinensis Alligator_sinensis_CCG014612.1 I 0.000
Alligator_sinensis_CCG015961.1 Alligator sinensis Alligator_sinensis_CCG015961.1 I 0.000
ALUE_0001238401 Ascaris lumbricoides ALUE_0001238401 I 0.000
ALUE_0001765001 Ascaris lumbricoides ALUE_0001765001 I 0.000
AMAM011266 Anopheles maculatus AMAM011266 I 0.000
AMAM013784 Anopheles maculatus AMAM013784 I 0.000
AMAM017329 Anopheles maculatus AMAM017329 I 0.000
AMAM019262 Anopheles maculatus AMAM019262 I 0.000
AMEC003288 Anopheles melas AMEC003288 N 0.000
AMEC006016 Anopheles melas AMEC006016 I 0.000
AMEC009924 Anopheles melas AMEC009924 I 0.000
AMEC010222 Anopheles melas AMEC010222 I 0.000
AMEC013541 Anopheles melas AMEC013541 I 0.000
AMEC018206 Anopheles melas AMEC018206 I 0.000
AMEM003521 Anopheles merus AMEM003521 I 0.000
AMEM005864 Anopheles merus AMEM005864 I 0.000
AMEM008700 Anopheles merus AMEM008700 I 0.000
AMEM010154 Anopheles merus AMEM010154 I 0.000
AMEM018184 Anopheles merus AMEM018184 I 0.000
AMIN000110 Anopheles minimus AMIN000110 I 0.000
AMIN002453 Anopheles minimus AMIN002453 I 0.000
AMIN003425 Anopheles minimus AMIN003425 I 0.000
AMIN003427 Anopheles minimus AMIN003427 I 0.000
AMIN006247 Anopheles minimus AMIN006247 I 0.000
ANCCAN_10727 Ancylostoma caninum ANCCAN_10727 I 0.000
ANCCAN_12522 Ancylostoma caninum ANCCAN_12522 I 0.000
ANCCEY_02133 Ancylostoma ceylanicum ANCCEY_02133 I 0.000
ANCCEY_05038 Ancylostoma ceylanicum ANCCEY_05038 I 0.000
ANCDUO_02875 Ancylostoma duodenale ANCDUO_02875 I 0.000
ANCDUO_04113 Ancylostoma duodenale ANCDUO_04113 I 0.000
ANCDUO_14705 Ancylostoma duodenale ANCDUO_14705 I 0.000
AQUA000093 Anopheles quadriannulatus AQUA000093 I 0.000
AQUA000433 Anopheles quadriannulatus AQUA000433 I 0.000
AQUA000480 Anopheles quadriannulatus AQUA000480 I 0.000
AQUA000483 Anopheles quadriannulatus AQUA000483 I 0.000
AQUA000642 Anopheles quadriannulatus AQUA000642 I 0.000
AQUA000643 Anopheles quadriannulatus AQUA000643 I 0.000
AQUA001638 Anopheles quadriannulatus AQUA001638 I 0.000
ASIM_0000400001 Anisakis simplex ASIM_0000400001 I 0.000
ASIM_0001132501 Anisakis simplex ASIM_0001132501 I 0.000
ASIM_0001467601 Anisakis simplex ASIM_0001467601 I 0.000
ASIM_0001502101 Anisakis simplex ASIM_0001502101 I 0.000
ASIM_0001653501 Anisakis simplex ASIM_0001653501 I 0.000
ASIS004766 Anopheles sinensis ASIS004766 I 0.000
ASIS010124 Anopheles sinensis ASIS010124 I 0.000
ASIS018066 Anopheles sinensis ASIS018066 I 0.000
ASIS018158 Anopheles sinensis ASIS018158 N 0.000
ASIS018974 Anopheles sinensis ASIS018974 I 0.000
ASTEI01784 Anopheles stephensi ASTEI01784 I 0.000
ASTEI01785 Anopheles stephensi ASTEI01785 I 0.000
ASTEI05423 Anopheles stephensi ASTEI05423 I 0.000
ASTEI05484 Anopheles stephensi ASTEI05484 I 0.000
ASTEI05486 Anopheles stephensi ASTEI05486 I 0.000
ASTEI06928 Anopheles stephensi ASTEI06928 I 0.000
ASU_06855 Ascaris suum ASU_06855 I 0.000
augustus_masked-nMf.1.1.scaf00990-processed-gene-0.2 Meloidogyne floridensis augustus_masked-nMf.1.1.scaf00990-processed-gene-0.2 I 0.000
augustus_masked-nMf.1.1.scaf12078-processed-gene-0.0 Meloidogyne floridensis augustus_masked-nMf.1.1.scaf12078-processed-gene-0.0 I 0.000
A_00805 Schistosoma haematobium A_00805 I 0.000
A_02929 Schistosoma haematobium A_02929 I 0.000
BGIBMGA006395 Bombyx mori BGIBMGA006395 I 0.000
BGIBMGA009644 Bombyx mori BGIBMGA009644 I 0.000
BGIBMGA009798 Bombyx mori BGIBMGA009798 I 0.000
BGIBMGA010035 Bombyx mori BGIBMGA010035 N 0.000
BGIBMGA010980 Bombyx mori BGIBMGA010980 I 0.000
BGLB002983 Biomphalaria glabrata BGLB002983 I 0.000
BGLB003458 Biomphalaria glabrata BGLB003458 I 0.000
BGLB006628 Biomphalaria glabrata BGLB006628 I 0.000
BGLB007299 Biomphalaria glabrata BGLB007299 I 0.000
Bm2180 Brugia malayi Bm2180 I 0.000
Bm2422 Brugia malayi Bm2422 I 0.000
Bm3793 Brugia malayi Bm3793 I 0.000
Brh_R006942 Buceros rhinoceros Brh_R006942 I 0.000
Brh_R008675 Buceros rhinoceros Brh_R008675 I 0.000
BTMF_0000584401 Brugia timori BTMF_0000584401 I 0.000
BTMF_0000838401 Brugia timori BTMF_0000838401 I 0.000
BTMF_0001481201 Brugia timori BTMF_0001481201 I 0.000
BXY_0637300 Bursaphelenchus xylophilus BXY_0637300 I 0.000
CAA34746 Xenopus laevis CAA34746 I 0.000
CapteG152542 Capitella teleta CapteG152542 I 0.000
CapteG152545 Capitella teleta CapteG152545 I 0.000
CapteG156652 Capitella teleta CapteG156652 I 0.000
CapteG183448 Capitella teleta CapteG183448 I 0.000
CapteG196539 Capitella teleta CapteG196539 I 0.000
CapteG219808 Capitella teleta CapteG219808 I 0.000
CapteG25827 Capitella teleta CapteG25827 I 0.000
CapteG30874 Capitella teleta CapteG30874 I 0.000
CapteG71005 Capitella teleta CapteG71005 N 0.000
CapteG80769 Capitella teleta CapteG80769 I 0.000
CBG04023 Caenorhabditis briggsae CBG04023 I 0.000
CBG20241 Caenorhabditis briggsae CBG20241 I 0.000
CBG22920 Caenorhabditis briggsae CBG22920 I 0.000
CBN02342 Caenorhabditis brenneri CBN02342 I 0.000
CBN02632 Caenorhabditis brenneri CBN02632 I 0.000
CBN23323 Caenorhabditis brenneri CBN23323 I 0.000
Cflo_02933--XP_001120954.1_APIME Camponotus floridanus Cflo_02933--XP_001120954.1_APIME I 0.000
Cflo_04366--XP_624481.2_APIME Camponotus floridanus Cflo_04366--XP_624481.2_APIME I 0.000
Cflo_06767--XP_001121029.1_APIME Camponotus floridanus Cflo_06767--XP_001121029.1_APIME I 0.000
Cflo_06768--XP_001121029.1_APIME Camponotus floridanus Cflo_06768--XP_001121029.1_APIME I 0.000
Cflo_09678--XP_001121097.1_APIME Camponotus floridanus Cflo_09678--XP_001121097.1_APIME I 0.000
Cflo_10299--XP_394125.3_APIME Camponotus floridanus Cflo_10299--XP_394125.3_APIME I 0.000
CGI_10009942 Crassostrea gigas CGI_10009942 I 0.000
CGI_10012208 Crassostrea gigas CGI_10012208 I 0.000
CGI_10012209 Crassostrea gigas CGI_10012209 I 0.000
CGI_10015548 Crassostrea gigas CGI_10015548 I 0.000
CGI_10018603 Crassostrea gigas CGI_10018603 I 0.000
CGI_10024087 Crassostrea gigas CGI_10024087 I 0.000
CGI_10025052 Crassostrea gigas CGI_10025052 I 0.000
CGI_10025053 Crassostrea gigas CGI_10025053 I 0.000
CGOC_0000550601 Cylicostephanus goldi CGOC_0000550601 I 0.000
CJA05554 Caenorhabditis japonica CJA05554 I 0.000
CJA19276 Caenorhabditis japonica CJA19276 I 0.000
CLEC000966 Cimex lectularius CLEC000966 N 0.000
CLEC001685 Cimex lectularius CLEC001685 I 0.000
CLEC003391 Cimex lectularius CLEC003391 I 0.000
CLEC007879 Cimex lectularius CLEC007879 I 0.000
Cmyd_10002827 Chelonia mydas Cmyd_10002827 N 0.000
Cmyd_10006637 Chelonia mydas Cmyd_10006637 I 0.000
Cmyd_10006639 Chelonia mydas Cmyd_10006639 I 0.000
Cmyd_10010790 Chelonia mydas Cmyd_10010790 I 0.000
Cmyd_10011392 Chelonia mydas Cmyd_10011392 I 0.000
Cmyd_10015819 Chelonia mydas Cmyd_10015819 I 0.000
Cmyd_10016377 Chelonia mydas Cmyd_10016377 I 0.000
Cmyd_10017743 Chelonia mydas Cmyd_10017743 I 0.000
Cmyd_10020961 Chelonia mydas Cmyd_10020961 I 0.000
CPIJ001003 Culex quinquefasciatus CPIJ001003 I 0.000
CPIJ009088 Culex quinquefasciatus CPIJ009088 I 0.000
CPIJ009458 Culex quinquefasciatus CPIJ009458 I 0.000
CPIJ010220 Culex quinquefasciatus CPIJ010220 I 0.000
CpipJ_CPIJ001003 Culex pipiens CpipJ_CPIJ001003 I 0.000
CpipJ_CPIJ009088 Culex pipiens CpipJ_CPIJ009088 I 0.000
CpipJ_CPIJ009458 Culex pipiens CpipJ_CPIJ009458 I 0.000
CpipJ_CPIJ010220 Culex pipiens CpipJ_CPIJ010220 I 0.000
CRE03985 Caenorhabditis remanei CRE03985 I 0.000
CRE06735 Caenorhabditis remanei CRE06735 I 0.000
CRE28121 Caenorhabditis remanei CRE28121 I 0.000
csin101437 Clonorchis sinensis csin101437 I 0.000
csin108095 Clonorchis sinensis csin108095 I 0.000
csin108665 Clonorchis sinensis csin108665 I 0.000
csin112245 Clonorchis sinensis csin112245 I 0.000
C_01031 Schistosoma haematobium C_01031 I 0.000
C_01032 Schistosoma haematobium C_01032 I 0.000
D915_01334 Fasciola hepatica D915_01334 I 0.000
D915_02853 Fasciola hepatica D915_02853 I 0.000
D915_02868 Fasciola hepatica D915_02868 I 0.000
D915_07659 Fasciola hepatica D915_07659 I 0.000
D917_00714 Trichinella nativa D917_00714 I 0.000
D917_01807 Trichinella nativa D917_01807 I 0.000
D917_05736 Trichinella nativa D917_05736 I 0.000
D918_00499 Trichuris suis D918_00499 I 0.000
D918_00727 Trichuris suis D918_00727 I 0.000
DAPPUDRAFT_290629 Daphnia pulex DAPPUDRAFT_290629 I 0.000
DAPPUDRAFT_290630 Daphnia pulex DAPPUDRAFT_290630 I 0.000
DAPPUDRAFT_347135 Daphnia pulex DAPPUDRAFT_347135 I 0.000
DAPPUDRAFT_38036 Daphnia pulex DAPPUDRAFT_38036 I 0.000
DAPPUDRAFT_38070 Daphnia pulex DAPPUDRAFT_38070 I 0.000
DAPPUDRAFT_55144 Daphnia pulex DAPPUDRAFT_55144 I 0.000
DICVIV_01361 Dictyocaulus viviparus DICVIV_01361 I 0.000
DICVIV_11890 Dictyocaulus viviparus DICVIV_11890 I 0.000
DILT_0000634101 Diphyllobothrium latum DILT_0000634101 I 0.000
DILT_0000923301 Diphyllobothrium latum DILT_0000923301 I 0.000
DME_0000218401 Dracunculus medinensis DME_0000218401 I 0.000
DME_0000293901 Dracunculus medinensis DME_0000293901 I 0.000
DME_0000365001 Dracunculus medinensis DME_0000365001 I 0.000
DME_0001008101 Dracunculus medinensis DME_0001008101 I 0.000
ECANG7_01855 Echinococcus canadensis ECANG7_01855 I 0.000
ECANG7_05492 Echinococcus canadensis ECANG7_05492 I 0.000
ECPE_0000513901 Echinostoma caproni ECPE_0000513901 I 0.000
EEL_0000037701 Elaeophora elaphi EEL_0000037701 I 0.000
EEL_0000392901 Elaeophora elaphi EEL_0000392901 I 0.000
EFV53889 Trichinella spiralis EFV53889 I 0.000
EFV56732 Trichinella spiralis EFV56732 I 0.000
EFV57047 Trichinella spiralis EFV57047 I 0.000
EFV58116 Trichinella spiralis EFV58116 I 0.000
EmuJ_000394900 Echinococcus multilocularis EmuJ_000394900 I 0.000
ENSACAG00000001792 Anolis carolinensis ENSACAG00000001792 I 0.000
PDX1 Anolis carolinensis ENSACAG00000003305 I 0.000
ENSACAG00000006508 Anolis carolinensis ENSACAG00000006508 I 0.000
ENSACAG00000008059 Anolis carolinensis ENSACAG00000008059 I 0.000
EMX2 Anolis carolinensis ENSACAG00000010339 I 0.000
ENSACAG00000010401 Anolis carolinensis ENSACAG00000010401 I 0.000
GSX2 Anolis carolinensis ENSACAG00000010497 I 0.000
EN2 Anolis carolinensis ENSACAG00000011018 I 0.000
HOXD3 Anolis carolinensis ENSACAG00000017904 I 0.000
ENSACAG00000022360 Anolis carolinensis ENSACAG00000022360 I 0.000
ENSAMEG00000001224 Ailuropoda melanoleuca ENSAMEG00000001224 I 0.000
ENSAMEG00000001830 Ailuropoda melanoleuca ENSAMEG00000001830 I 0.000
ENSAMEG00000002418 Ailuropoda melanoleuca ENSAMEG00000002418 I 0.000
ENSAMEG00000005904 Ailuropoda melanoleuca ENSAMEG00000005904 I 0.000
ENSAMEG00000008454 Ailuropoda melanoleuca ENSAMEG00000008454 I 0.000
ENSAMEG00000014148 Ailuropoda melanoleuca ENSAMEG00000014148 I 0.000
ENSAMEG00000015623 Ailuropoda melanoleuca ENSAMEG00000015623 I 0.000
ENSAMEG00000015868 Ailuropoda melanoleuca ENSAMEG00000015868 I 0.000
ENSAMEG00000018350 Ailuropoda melanoleuca ENSAMEG00000018350 I 0.000
ENSAMXG00000002112 Astyanax mexicanus ENSAMXG00000002112 I 0.000
ENSAMXG00000002611 Astyanax mexicanus ENSAMXG00000002611 I 0.000
ENSAMXG00000004085 Astyanax mexicanus ENSAMXG00000004085 I 0.000
ENSAMXG00000005233 Astyanax mexicanus ENSAMXG00000005233 I 0.000
ENSAMXG00000006593 Astyanax mexicanus ENSAMXG00000006593 I 0.000
ENSAMXG00000007001 Astyanax mexicanus ENSAMXG00000007001 I 0.000
ENSAMXG00000008331 Astyanax mexicanus ENSAMXG00000008331 I 0.000
ENSAMXG00000010923 Astyanax mexicanus ENSAMXG00000010923 I 0.000
ENSAMXG00000010998 Astyanax mexicanus ENSAMXG00000010998 I 0.000
ENSAMXG00000014404 Astyanax mexicanus ENSAMXG00000014404 I 0.000
ENSAMXG00000016014 Astyanax mexicanus ENSAMXG00000016014 I 0.000
ENSAMXG00000016079 Astyanax mexicanus ENSAMXG00000016079 I 0.000
ENSAMXG00000024264 Astyanax mexicanus ENSAMXG00000024264 I 0.000
ENSAPLG00000005982 Anas platyrhynchos ENSAPLG00000005982 I 0.000
ENSAPLG00000011194 Anas platyrhynchos ENSAPLG00000011194 I 0.000
ENSAPLG00000011431 Anas platyrhynchos ENSAPLG00000011431 I 0.000
ENSAPLG00000013677 Anas platyrhynchos ENSAPLG00000013677 I 0.000
ENSAPLG00000016164 Anas platyrhynchos ENSAPLG00000016164 I 0.000
EMX1 Bos taurus ENSBTAG00000001866 I 0.000
EMX2 Bos taurus ENSBTAG00000003027 I 0.000
HOXD3 Bos taurus ENSBTAG00000004835 I 0.000
HOXA3 Bos taurus ENSBTAG00000008139 I 0.000
PDX1 Bos taurus ENSBTAG00000010690 I 0.000
MEOX1 Bos taurus ENSBTAG00000015751 I 0.000
ENSBTAG00000018917 Bos taurus ENSBTAG00000018917 I 0.000
HOXB3 Bos taurus ENSBTAG00000021427 I 0.000
EN1 Bos taurus ENSBTAG00000021494 I 0.000
GSX2 Bos taurus ENSBTAG00000045812 I 0.000
ENSBTAP00000014141-D1 Bos grunniens ENSBTAP00000014141-D1 I 0.000
ENSBTAP00000038170-D1 Bos grunniens ENSBTAP00000038170-D1 I 0.000
GSX2 Canis familiaris ENSCAFG00000002052 I 0.000
EN2 Canis familiaris ENSCAFG00000005082 I 0.000
PDX1 Canis familiaris ENSCAFG00000006746 I 0.000
GSX1 Canis familiaris ENSCAFG00000006749 I 0.000
EMX2 Canis familiaris ENSCAFG00000011987 I 0.000
HOXD3 Canis familiaris ENSCAFG00000013464 I 0.000
HOXB3 Canis familiaris ENSCAFG00000028513 I 0.000
ENSCAFG00000030229 Canis familiaris ENSCAFG00000030229 I 0.000
HOXA3 Canis familiaris ENSCAFG00000032285 I 0.000
ENSCAFG00000032481 Canis familiaris ENSCAFG00000032481 I 0.000
PDX1 Choloepus hoffmanni ENSCHOG00000006329 I 0.000
HOXA3 Choloepus hoffmanni ENSCHOG00000009854 I 0.000
ENSCING00000000991 Ciona intestinalis ENSCING00000000991 I 0.000
hoxa2 Ciona intestinalis ENSCING00000005160 I 0.000
ENSCING00000006963 Ciona intestinalis ENSCING00000006963 I 0.000
ENSCING00000017406 Ciona intestinalis ENSCING00000017406 I 0.000
ENSCING00000023042 Ciona intestinalis ENSCING00000023042 I 0.000
EMX1 Callithrix jacchus ENSCJAG00000003874 I 0.000
HOXB3 Callithrix jacchus ENSCJAG00000007487 I 0.000
HOXA3 Callithrix jacchus ENSCJAG00000008046 I 0.000
NKX1-1 Callithrix jacchus ENSCJAG00000009458 I 0.000
EN2 Callithrix jacchus ENSCJAG00000017450 I 0.000
GSX2 Callithrix jacchus ENSCJAG00000018454 I 0.000
GSX1 Callithrix jacchus ENSCJAG00000019388 I 0.000
PDX1 Callithrix jacchus ENSCJAG00000019393 I 0.000
EMX2 Callithrix jacchus ENSCJAG00000019535 I 0.000
EMX2 Cavia porcellus ENSCPOG00000003299 I 0.000
GSX2 Cavia porcellus ENSCPOG00000005837 I 0.000
ENSCPOG00000006169 Cavia porcellus ENSCPOG00000006169 I 0.000
ENSCPOG00000013498 Cavia porcellus ENSCPOG00000013498 I 0.000
EN1 Cavia porcellus ENSCPOG00000014063 I 0.000
EN2 Cavia porcellus ENSCPOG00000024572 I 0.000
ENSCPOG00000025136 Cavia porcellus ENSCPOG00000025136 I 0.000
ENSCPOG00000026854 Cavia porcellus ENSCPOG00000026854 I 0.000
ENSCSAG00000002533 Chlorocebus sabaeus ENSCSAG00000002533 I 0.000
ENSCSAG00000004790 Chlorocebus sabaeus ENSCSAG00000004790 I 0.000
ENSCSAG00000004981 Chlorocebus sabaeus ENSCSAG00000004981 I 0.000
ENSCSAG00000006501 Chlorocebus sabaeus ENSCSAG00000006501 I 0.000
ENSCSAG00000014267 Chlorocebus sabaeus ENSCSAG00000014267 I 0.000
ENSCSAG00000014422 Chlorocebus sabaeus ENSCSAG00000014422 I 0.000
ENSCSAG00000015316 Chlorocebus sabaeus ENSCSAG00000015316 I 0.000
ENSCSAG00000016540 Chlorocebus sabaeus ENSCSAG00000016540 I 0.000
ENSCSAG00000017977 Chlorocebus sabaeus ENSCSAG00000017977 I 0.000
ENSCSAG00000017979 Chlorocebus sabaeus ENSCSAG00000017979 I 0.000
ENSCSAVG00000001698 Ciona savignyi ENSCSAVG00000001698 I 0.000
ENSCSAVG00000001985 Ciona savignyi ENSCSAVG00000001985 I 0.000
ENSCSAVG00000008011 Ciona savignyi ENSCSAVG00000008011 I 0.000
ENSCSAVG00000008736 Ciona savignyi ENSCSAVG00000008736 I 0.000
ENSCSAVG00000008872 Ciona savignyi ENSCSAVG00000008872 I 0.000
pdx1 Danio rerio ENSDARG00000002779 I 0.000
en1a Danio rerio ENSDARG00000014321 I 0.000
emx3 Danio rerio ENSDARG00000020417 I 0.000
pnx Danio rerio ENSDARG00000025899 I 0.000
en2a Danio rerio ENSDARG00000026599 I 0.000
hoxb3a Danio rerio ENSDARG00000029263 I 0.000
gsx1 Danio rerio ENSDARG00000035735 I 0.000
en2b Danio rerio ENSDARG00000038868 I 0.000
emx1 Danio rerio ENSDARG00000039569 I 0.000
emx2 Danio rerio ENSDARG00000039701 I 0.000
gsx2 Danio rerio ENSDARG00000043322 I 0.000
hoxd3a Danio rerio ENSDARG00000059280 I 0.000
en1b Danio rerio ENSDARG00000098730 I 0.000
hoxa4a Danio rerio ENSDARG00000103862 I 0.000
PDX1 Dasypus novemcinctus ENSDNOG00000003213 I 0.000
TLX3 Dasypus novemcinctus ENSDNOG00000011151 I 0.000
GSX1 Dasypus novemcinctus ENSDNOG00000011821 I 0.000
HOXA3 Dasypus novemcinctus ENSDNOG00000033211 I 0.000
HOXD3 Dasypus novemcinctus ENSDNOG00000035593 I 0.000
EN2 Dasypus novemcinctus ENSDNOG00000037306 I 0.000
HOXB3 Dasypus novemcinctus ENSDNOG00000043480 I 0.000
EN1 Dasypus novemcinctus ENSDNOG00000044865 I 0.000
GSX2 Dasypus novemcinctus ENSDNOG00000045933 I 0.000
EMX2 Dasypus novemcinctus ENSDNOG00000047293 I 0.000
EMX1 Dasypus novemcinctus ENSDNOG00000048933 I 0.000
ENSDORG00000000013 Dipodomys ordii ENSDORG00000000013 I 0.000
Gsx2 Dipodomys ordii ENSDORG00000000416 I 0.000
ENSDORG00000006313 Dipodomys ordii ENSDORG00000006313 I 0.000
Emx1 Dipodomys ordii ENSDORG00000006951 I 0.000
Hoxb3 Dipodomys ordii ENSDORG00000007898 I 0.000
Pdx1 Dipodomys ordii ENSDORG00000008418 I 0.000
ENSDORG00000009443 Dipodomys ordii ENSDORG00000009443 I 0.000
ENSECAG00000000157 Equus caballus ENSECAG00000000157 I 0.000
GSX1 Equus caballus ENSECAG00000000439 I 0.000
PDX1 Equus caballus ENSECAG00000000679 I 0.000
ENSECAG00000002707 Equus caballus ENSECAG00000002707 I 0.000
GSX2 Equus caballus ENSECAG00000013430 I 0.000
ENSECAG00000016125 Equus caballus ENSECAG00000016125 I 0.000
EMX2 Equus caballus ENSECAG00000021102 I 0.000
EN2 Equus caballus ENSECAG00000021744 I 0.000
ENSECAG00000022055 Equus caballus ENSECAG00000022055 I 0.000
HOXD3 Equus caballus ENSECAG00000022129 I 0.000
HOXA3 Erinaceus europaeus ENSEEUG00000003189 I 0.000
EN2 Erinaceus europaeus ENSEEUG00000004213 I 0.000
GSX2 Erinaceus europaeus ENSEEUG00000004576 I 0.000
EMX2 Erinaceus europaeus ENSEEUG00000005741 I 0.000
PDX1 Erinaceus europaeus ENSEEUG00000007501 I 0.000
EMX2 Echinops telfairi ENSETEG00000003107 I 0.000
PDX1 Echinops telfairi ENSETEG00000004114 I 0.000
EN2 Echinops telfairi ENSETEG00000004995 I 0.000
GSX2 Echinops telfairi ENSETEG00000007498 I 0.000
HOXD3 Echinops telfairi ENSETEG00000019407 I 0.000
ENSFALG00000002201 Ficedula albicollis ENSFALG00000002201 I 0.000
ENSFALG00000003190 Ficedula albicollis ENSFALG00000003190 I 0.000
ENSFALG00000003404 Ficedula albicollis ENSFALG00000003404 I 0.000
ENSFALG00000006888 Ficedula albicollis ENSFALG00000006888 I 0.000
ENSFALG00000008588 Ficedula albicollis ENSFALG00000008588 I 0.000
ENSFALG00000008593 Ficedula albicollis ENSFALG00000008593 I 0.000
ENSFALG00000009475 Ficedula albicollis ENSFALG00000009475 I 0.000
ENSFALG00000012453 Ficedula albicollis ENSFALG00000012453 I 0.000
ENSFALG00000013644 Ficedula albicollis ENSFALG00000013644 I 0.000
ENSFALG00000014729 Ficedula albicollis ENSFALG00000014729 I 0.000
HOXB3 Felis catus ENSFCAG00000006408 I 0.000
BARHL1 Felis catus ENSFCAG00000007105 I 0.000
PDX1 Felis catus ENSFCAG00000010351 I 0.000
ENSFCAG00000023560 Felis catus ENSFCAG00000023560 I 0.000
EN1 Felis catus ENSFCAG00000025025 I 0.000
GSX2 Felis catus ENSFCAG00000025271 I 0.000
ENSFCAG00000026793 Felis catus ENSFCAG00000026793 I 0.000
ENSFCAG00000028912 Felis catus ENSFCAG00000028912 I 0.000
HOXA3 Felis catus ENSFCAG00000028952 I 0.000
HOXA3 Homo sapiens ENSG00000105997 D 0.000
HOXB3 Homo sapiens ENSG00000120093 D 0.000
HOXD3 Homo sapiens ENSG00000128652 D 0.000
MNX1 Homo sapiens ENSG00000130675 D 0.000
EMX1 Homo sapiens ENSG00000135638 D 0.000
PDX1 Homo sapiens ENSG00000139515 D 0.000
EN1 Homo sapiens ENSG00000163064 D 0.000
EN2 Homo sapiens ENSG00000164778 D 0.000
GSX1 Homo sapiens ENSG00000169840 D 0.000
EMX2 Homo sapiens ENSG00000170370 D 0.000
GSX2 Homo sapiens ENSG00000180613 D 0.000
pnx Gasterosteus aculeatus ENSGACG00000000854 I 0.000
en1a Gasterosteus aculeatus ENSGACG00000001508 I 0.000
pdx1 Gasterosteus aculeatus ENSGACG00000003099 I 0.000
emx2 Gasterosteus aculeatus ENSGACG00000003199 I 0.000
en2a Gasterosteus aculeatus ENSGACG00000003888 I 0.000
ENSGACG00000003942 Gasterosteus aculeatus ENSGACG00000003942 I 0.000
hoxd3a Gasterosteus aculeatus ENSGACG00000004548 I 0.000
emx1 Gasterosteus aculeatus ENSGACG00000004860 I 0.000
ENSGACG00000005631 Gasterosteus aculeatus ENSGACG00000005631 I 0.000
hoxa4a Gasterosteus aculeatus ENSGACG00000007094 I 0.000
gsx2 Gasterosteus aculeatus ENSGACG00000014255 I 0.000
ENSGACG00000014426 Gasterosteus aculeatus ENSGACG00000014426 I 0.000
ENSGACG00000014956 Gasterosteus aculeatus ENSGACG00000014956 I 0.000
emx3 Gasterosteus aculeatus ENSGACG00000016370 I 0.000
GSX1 Gasterosteus aculeatus ENSGACG00000020684 I 0.000
ENSGACG00000020715 Gasterosteus aculeatus ENSGACG00000020715 I 0.000
EMX2 Gallus gallus ENSGALG00000009302 I 0.000
ENSGALG00000011054 Gallus gallus ENSGALG00000011054 I 0.000
ENSGALG00000013455 Gallus gallus ENSGALG00000013455 I 0.000
ENSGALG00000016095 Gallus gallus ENSGALG00000016095 I 0.000
ENSGALG00000022726 Gallus gallus ENSGALG00000022726 I 0.000
HOXD3 Gallus gallus ENSGALG00000023420 I 0.000
ENSGALG00000023430 Gallus gallus ENSGALG00000023430 I 0.000
ENSGALG00000025740 Gallus gallus ENSGALG00000025740 I 0.000
ENSGALG00000027925 Gallus gallus ENSGALG00000027925 I 0.000
ALX1 Gorilla gorilla ENSGGOG00000000168 I 0.000
HOXD3 Gorilla gorilla ENSGGOG00000001346 I 0.000
HOXA3 Gorilla gorilla ENSGGOG00000002213 I 0.000
PDX1 Gorilla gorilla ENSGGOG00000002569 I 0.000
GSX1 Gorilla gorilla ENSGGOG00000005011 I 0.000
GSX2 Gorilla gorilla ENSGGOG00000007928 I 0.000
HOXB3 Gorilla gorilla ENSGGOG00000012838 I 0.000
EMX2 Gorilla gorilla ENSGGOG00000016667 I 0.000
EN2 Gorilla gorilla ENSGGOG00000022981 I 0.000
EN1 Gorilla gorilla ENSGGOG00000024767 I 0.000
ENSGGOG00000027271 Gorilla gorilla ENSGGOG00000027271 I 0.000
ENSGMOG00000002267 Gadus morhua ENSGMOG00000002267 I 0.000
ENSGMOG00000002543 Gadus morhua ENSGMOG00000002543 I 0.000
ENSGMOG00000003182 Gadus morhua ENSGMOG00000003182 I 0.000
ENSGMOG00000004252 Gadus morhua ENSGMOG00000004252 I 0.000
ENSGMOG00000004983 Gadus morhua ENSGMOG00000004983 I 0.000
ENSGMOG00000005154 Gadus morhua ENSGMOG00000005154 I 0.000
ENSGMOG00000006160 Gadus morhua ENSGMOG00000006160 I 0.000
ENSGMOG00000006424 Gadus morhua ENSGMOG00000006424 I 0.000
ENSGMOG00000009880 Gadus morhua ENSGMOG00000009880 I 0.000
ENSGMOG00000010284 Gadus morhua ENSGMOG00000010284 I 0.000
ENSGMOG00000011340 Gadus morhua ENSGMOG00000011340 N 0.000
ENSGMOG00000013841 Gadus morhua ENSGMOG00000013841 I 0.000
ENSGMOG00000014682 Gadus morhua ENSGMOG00000014682 I 0.000
ENSGMOG00000015225 Gadus morhua ENSGMOG00000015225 I 0.000
ENSGMOG00000015411 Gadus morhua ENSGMOG00000015411 I 0.000
ENSGMOG00000015872 Gadus morhua ENSGMOG00000015872 I 0.000
ENSGMOG00000018280 Gadus morhua ENSGMOG00000018280 I 0.000
ENSLACG00000001475 Latimeria chalumnae ENSLACG00000001475 I 0.000
ENSLACG00000007176 Latimeria chalumnae ENSLACG00000007176 I 0.000
ENSLACG00000007818 Latimeria chalumnae ENSLACG00000007818 I 0.000
ENSLACG00000008420 Latimeria chalumnae ENSLACG00000008420 I 0.000
ENSLACG00000008444 Latimeria chalumnae ENSLACG00000008444 I 0.000
ENSLACG00000014520 Latimeria chalumnae ENSLACG00000014520 I 0.000
ENSLACG00000014824 Latimeria chalumnae ENSLACG00000014824 I 0.000
ENSLACG00000016379 Latimeria chalumnae ENSLACG00000016379 I 0.000
ENSLACG00000016502 Latimeria chalumnae ENSLACG00000016502 I 0.000
ENSLACG00000016610 Latimeria chalumnae ENSLACG00000016610 I 0.000
ENSLACG00000017247 Latimeria chalumnae ENSLACG00000017247 I 0.000
ENSLACG00000017310 Latimeria chalumnae ENSLACG00000017310 I 0.000
HOXD3 Loxodonta africana ENSLAFG00000005477 I 0.000
EMX1 Loxodonta africana ENSLAFG00000007063 I 0.000
EMX2 Loxodonta africana ENSLAFG00000016071 I 0.000
HOXA3 Loxodonta africana ENSLAFG00000023253 I 0.000
EN1 Loxodonta africana ENSLAFG00000026702 I 0.000
HOXB3 Loxodonta africana ENSLAFG00000030335 I 0.000
ENSLAFG00000032115 Loxodonta africana ENSLAFG00000032115 I 0.000
ENSLOCG00000003193 Lepisosteus oculatus ENSLOCG00000003193 I 0.000
ENSLOCG00000004253 Lepisosteus oculatus ENSLOCG00000004253 I 0.000
ENSLOCG00000004260 Lepisosteus oculatus ENSLOCG00000004260 I 0.000
ENSLOCG00000006407 Lepisosteus oculatus ENSLOCG00000006407 I 0.000
ENSLOCG00000007043 Lepisosteus oculatus ENSLOCG00000007043 I 0.000
ENSLOCG00000009348 Lepisosteus oculatus ENSLOCG00000009348 I 0.000
ENSLOCG00000009698 Lepisosteus oculatus ENSLOCG00000009698 I 0.000
ENSLOCG00000011801 Lepisosteus oculatus ENSLOCG00000011801 I 0.000
ENSLOCG00000012156 Lepisosteus oculatus ENSLOCG00000012156 I 0.000
ENSLOCG00000012504 Lepisosteus oculatus ENSLOCG00000012504 I 0.000
ENSLOCG00000013436 Lepisosteus oculatus ENSLOCG00000013436 I 0.000
ENSLOCG00000014145 Lepisosteus oculatus ENSLOCG00000014145 I 0.000
ENSLOCG00000014149 Lepisosteus oculatus ENSLOCG00000014149 I 0.000
ENSMEUG00000000097 Macropus eugenii ENSMEUG00000000097 I 0.000
ENSMEUG00000008957 Macropus eugenii ENSMEUG00000008957 I 0.000
ENSMEUG00000013399 Macropus eugenii ENSMEUG00000013399 I 0.000
ENSMEUG00000015148 Macropus eugenii ENSMEUG00000015148 I 0.000
ENSMEUG00000016549 Macropus eugenii ENSMEUG00000016549 I 0.000
ENSMEUG00000016587 Macropus eugenii ENSMEUG00000016587 I 0.000
ENSMGAG00000006701 Meleagris gallopavo ENSMGAG00000006701 I 0.000
ENSMGAG00000010687 Meleagris gallopavo ENSMGAG00000010687 I 0.000
ENSMGAG00000012331 Meleagris gallopavo ENSMGAG00000012331 I 0.000
PDX1 Meleagris gallopavo ENSMGAG00000015099 I 0.000
ENSMGAG00000015339 Meleagris gallopavo ENSMGAG00000015339 I 0.000
ENSMICG00000000477 Microcebus murinus ENSMICG00000000477 I 0.000
HOXD3 Microcebus murinus ENSMICG00000004286 I 0.000
HOXB3 Microcebus murinus ENSMICG00000007522 I 0.000
ENSMICG00000010178 Microcebus murinus ENSMICG00000010178 I 0.000
EMX2 Microcebus murinus ENSMICG00000015676 I 0.000
ENSMICG00000017594 Microcebus murinus ENSMICG00000017594 I 0.000
EN2 Myotis lucifugus ENSMLUG00000004165 I 0.000
GSX2 Myotis lucifugus ENSMLUG00000006733 I 0.000
EN1 Myotis lucifugus ENSMLUG00000008461 I 0.000
PDX1 Myotis lucifugus ENSMLUG00000010639 I 0.000
HOXD3 Myotis lucifugus ENSMLUG00000012510 I 0.000
HOXA3 Myotis lucifugus ENSMLUG00000014502 I 0.000
EMX2 Myotis lucifugus ENSMLUG00000022576 I 0.000
EMX1 Myotis lucifugus ENSMLUG00000025017 I 0.000
ENSMMUG00000002299 Macaca mulatta ENSMMUG00000002299 I 0.000
ENSMMUG00000002609 Macaca mulatta ENSMMUG00000002609 I 0.000
ENSMMUG00000004507 Macaca mulatta ENSMMUG00000004507 I 0.000
ENSMMUG00000006384 Macaca mulatta ENSMMUG00000006384 I 0.000
ENSMMUG00000007768 Macaca mulatta ENSMMUG00000007768 I 0.000
ENSMMUG00000012415 Macaca mulatta ENSMMUG00000012415 I 0.000
ENSMMUG00000012813 Macaca mulatta ENSMMUG00000012813 I 0.000
ENSMMUG00000016136 Macaca mulatta ENSMMUG00000016136 I 0.000
ENSMMUG00000022277 Macaca mulatta ENSMMUG00000022277 I 0.000
ENSMMUP00000008418 Macaca fascicularis ENSMMUP00000008418 I 0.000
EN1 Monodelphis domestica ENSMODG00000000438 I 0.000
ENSMODG00000000494 Monodelphis domestica ENSMODG00000000494 I 0.000
EN2 Monodelphis domestica ENSMODG00000004978 I 0.000
ENSMODG00000009010 Monodelphis domestica ENSMODG00000009010 I 0.000
PDX1 Monodelphis domestica ENSMODG00000009015 I 0.000
EMX2 Monodelphis domestica ENSMODG00000009388 I 0.000
BARHL2 Monodelphis domestica ENSMODG00000012056 I 0.000
ENSMODG00000012344 Monodelphis domestica ENSMODG00000012344 I 0.000
GSX2 Monodelphis domestica ENSMODG00000020668 I 0.000
ENSMODG00000029297 Monodelphis domestica ENSMODG00000029297 I 0.000
ENSMPUG00000000896 Mustela putorius furo ENSMPUG00000000896 I 0.000
ENSMPUG00000003297 Mustela putorius furo ENSMPUG00000003297 I 0.000
ENSMPUG00000004727 Mustela putorius furo ENSMPUG00000004727 I 0.000
ENSMPUG00000005147 Mustela putorius furo ENSMPUG00000005147 I 0.000
ENSMPUG00000005153 Mustela putorius furo ENSMPUG00000005153 I 0.000
ENSMPUG00000005814 Mustela putorius furo ENSMPUG00000005814 I 0.000
ENSMPUG00000006459 Mustela putorius furo ENSMPUG00000006459 I 0.000
ENSMPUG00000007523 Mustela putorius furo ENSMPUG00000007523 I 0.000
ENSMPUG00000009596 Mustela putorius furo ENSMPUG00000009596 I 0.000
ENSMPUG00000014072 Mustela putorius furo ENSMPUG00000014072 I 0.000
Pdx1 Mus musculus ENSMUSG00000029644 D 0.000
Emx1 Mus musculus ENSMUSG00000033726 I 0.000
Gsx2 Mus musculus ENSMUSG00000035946 D 0.000
En2 Mus musculus ENSMUSG00000039095 D 0.000
Emx2 Mus musculus ENSMUSG00000043969 D 0.000
Hoxb3 Mus musculus ENSMUSG00000048763 D 0.000
Gsx1 Mus musculus ENSMUSG00000053129 I 0.000
En1 Mus musculus ENSMUSG00000058665 D 0.000
Hoxd3 Mus musculus ENSMUSG00000079277 D 0.000
Hoxa3 Mus musculus ENSMUSG00000079560 D 0.000
ENSNLEG00000000360 Nomascus leucogenys ENSNLEG00000000360 I 0.000
ENSNLEG00000000362 Nomascus leucogenys ENSNLEG00000000362 I 0.000
ENSNLEG00000006018 Nomascus leucogenys ENSNLEG00000006018 I 0.000
ENSNLEG00000008278 Nomascus leucogenys ENSNLEG00000008278 I 0.000
ENSNLEG00000010370 Nomascus leucogenys ENSNLEG00000010370 I 0.000
ENSNLEG00000011874 Nomascus leucogenys ENSNLEG00000011874 I 0.000
ENSNLEG00000015389 Nomascus leucogenys ENSNLEG00000015389 I 0.000
ENSNLEG00000016605 Nomascus leucogenys ENSNLEG00000016605 I 0.000
ENSOANG00000002989 Ornithorhynchus anatinus ENSOANG00000002989 I 0.000
EMX2 Ornithorhynchus anatinus ENSOANG00000005368 I 0.000
ENSOANG00000006149 Ornithorhynchus anatinus ENSOANG00000006149 I 0.000
HOXD3 Ornithorhynchus anatinus ENSOANG00000008618 I 0.000
ENSOANG00000009063 Ornithorhynchus anatinus ENSOANG00000009063 I 0.000
PDX1 Ornithorhynchus anatinus ENSOANG00000009064 I 0.000
ENSOARG00000006722 Ovis aries ENSOARG00000006722 I 0.000
ENSOARG00000007106 Ovis aries ENSOARG00000007106 I 0.000
ENSOARG00000009797 Ovis aries ENSOARG00000009797 I 0.000
ENSOARG00000011643 Ovis aries ENSOARG00000011643 I 0.000
ENSOARG00000012314 Ovis aries ENSOARG00000012314 I 0.000
ENSOARG00000012459 Ovis aries ENSOARG00000012459 I 0.000
ENSOARG00000017472 Ovis aries ENSOARG00000017472 I 0.000
ENSOARG00000018096 Ovis aries ENSOARG00000018096 I 0.000
ENSOARG00000018550 Ovis aries ENSOARG00000018550 I 0.000
ENSOARG00000018997 Ovis aries ENSOARG00000018997 I 0.000
ENSOCUG00000002453 Oryctolagus cuniculus ENSOCUG00000002453 I 0.000
GSX2 Oryctolagus cuniculus ENSOCUG00000004209 I 0.000
PDX1 Oryctolagus cuniculus ENSOCUG00000004891 I 0.000
EN1 Oryctolagus cuniculus ENSOCUG00000011901 I 0.000
EMX2 Oryctolagus cuniculus ENSOCUG00000012088 I 0.000
HOXD3 Oryctolagus cuniculus ENSOCUG00000014119 I 0.000
HOXB3 Oryctolagus cuniculus ENSOCUG00000023337 I 0.000
GSX1 Oryctolagus cuniculus ENSOCUG00000023424 I 0.000
HOXB2 Oryctolagus cuniculus ENSOCUG00000024951 I 0.000
HOXA3 Oryctolagus cuniculus ENSOCUG00000027405 I 0.000
EN2 Otolemur garnettii ENSOGAG00000005579 I 0.000
EMX2 Otolemur garnettii ENSOGAG00000007277 I 0.000
GSX1 Otolemur garnettii ENSOGAG00000011242 I 0.000
GSX2 Otolemur garnettii ENSOGAG00000015271 I 0.000
HOXD3 Otolemur garnettii ENSOGAG00000015710 I 0.000
PDX1 Otolemur garnettii ENSOGAG00000016688 I 0.000
HOXA3 Otolemur garnettii ENSOGAG00000027664 I 0.000
EN1 Otolemur garnettii ENSOGAG00000030888 I 0.000
HOXB3 Otolemur garnettii ENSOGAG00000032090 I 0.000
EMX1 Otolemur garnettii ENSOGAG00000032418 I 0.000
ENSONIG00000003021 Oreochromis niloticus ENSONIG00000003021 I 0.000
ENSONIG00000004310 Oreochromis niloticus ENSONIG00000004310 I 0.000
ENSONIG00000004593 Oreochromis niloticus ENSONIG00000004593 I 0.000
ENSONIG00000005163 Oreochromis niloticus ENSONIG00000005163 I 0.000
ENSONIG00000005940 Oreochromis niloticus ENSONIG00000005940 I 0.000
ENSONIG00000006188 Oreochromis niloticus ENSONIG00000006188 I 0.000
ENSONIG00000008610 Oreochromis niloticus ENSONIG00000008610 I 0.000
ENSONIG00000009704 Oreochromis niloticus ENSONIG00000009704 I 0.000
ENSONIG00000010343 Oreochromis niloticus ENSONIG00000010343 I 0.000
ENSONIG00000012049 Oreochromis niloticus ENSONIG00000012049 I 0.000
ENSONIG00000012290 Oreochromis niloticus ENSONIG00000012290 I 0.000
ENSONIG00000014137 Oreochromis niloticus ENSONIG00000014137 I 0.000
ENSONIG00000017432 Oreochromis niloticus ENSONIG00000017432 I 0.000
HOXA3 Ochotona princeps ENSOPRG00000010401 I 0.000
PDX1 Ochotona princeps ENSOPRG00000011346 I 0.000
GSX2 Ochotona princeps ENSOPRG00000011503 I 0.000
EMX2 Ochotona princeps ENSOPRG00000012882 I 0.000
EN1 Ochotona princeps ENSOPRG00000015660 I 0.000
EMX1 Ochotona princeps ENSOPRG00000015897 I 0.000
hoxa4a Oryzias latipes ENSORLG00000004996 I 0.000
gsx1 Oryzias latipes ENSORLG00000006664 I 0.000
HOXA2 Oryzias latipes ENSORLG00000007624 I 0.000
ENSORLG00000007924 Oryzias latipes ENSORLG00000007924 I 0.000
ENSORLG00000008039 Oryzias latipes ENSORLG00000008039 I 0.000
pdx1 Oryzias latipes ENSORLG00000008765 I 0.000
en2 Oryzias latipes ENSORLG00000010437 I 0.000
ENSORLG00000012370 Oryzias latipes ENSORLG00000012370 I 0.000
ENSORLG00000012375 Oryzias latipes ENSORLG00000012375 I 0.000
emx2 Oryzias latipes ENSORLG00000014157 I 0.000
ENSORLG00000017048 Oryzias latipes ENSORLG00000017048 I 0.000
hoxd3a Oryzias latipes ENSORLG00000017546 I 0.000
gsx2 Oryzias latipes ENSORLG00000019791 I 0.000
en1a Oryzias latipes ENSORLG00000020825 I 0.000
ENSP00000297375-D1 Bos grunniens ENSP00000297375-D1 I 0.000
ENSP00000304331 Macaca fascicularis ENSP00000304331 I 0.000
ENSP00000319118-D1 Bos grunniens ENSP00000319118-D1 I 0.000
ENSP00000358202 Macaca fascicularis ENSP00000358202 I 0.000
ENSP00000358202-D1 Bos grunniens ENSP00000358202-D1 I 0.000
ENSP00000370421 Macaca fascicularis ENSP00000370421 I 0.000
ENSP00000386114 Macaca fascicularis ENSP00000386114 I 0.000
ENSP00000386498 Macaca fascicularis ENSP00000386498 I 0.000
ENSPANG00000000543 Papio anubis ENSPANG00000000543 I 0.000
ENSPANG00000006776 Papio anubis ENSPANG00000006776 I 0.000
ENSPANG00000012683 Papio anubis ENSPANG00000012683 I 0.000
ENSPANG00000017129 Papio anubis ENSPANG00000017129 I 0.000
ENSPANG00000020616 Papio anubis ENSPANG00000020616 I 0.000
ENSPANG00000021441 Papio anubis ENSPANG00000021441 I 0.000
ENSPANG00000021694 Papio anubis ENSPANG00000021694 I 0.000
ENSPANG00000022097 Papio anubis ENSPANG00000022097 I 0.000
ENSPANG00000022887 Papio anubis ENSPANG00000022887 I 0.000
ENSPANG00000025837 Papio anubis ENSPANG00000025837 I 0.000
ENSPANG00000025912 Papio anubis ENSPANG00000025912 I 0.000
EMX2 Procavia capensis ENSPCAG00000005986 I 0.000
HOXC4 Procavia capensis ENSPCAG00000011039 I 0.000
ENSPCAG00000014347 Procavia capensis ENSPCAG00000014347 I 0.000
HOXA3 Procavia capensis ENSPCAG00000015473 I 0.000
ENSPCAG00000015677 Procavia capensis ENSPCAG00000015677 I 0.000
HOXD3 Procavia capensis ENSPCAG00000015801 I 0.000
ENSPFOG00000002004 Poecilia formosa ENSPFOG00000002004 I 0.000
ENSPFOG00000002649 Poecilia formosa ENSPFOG00000002649 I 0.000
ENSPFOG00000007211 Poecilia formosa ENSPFOG00000007211 I 0.000
ENSPFOG00000007668 Poecilia formosa ENSPFOG00000007668 I 0.000
ENSPFOG00000007891 Poecilia formosa ENSPFOG00000007891 I 0.000
ENSPFOG00000009935 Poecilia formosa ENSPFOG00000009935 I 0.000
ENSPFOG00000012165 Poecilia formosa ENSPFOG00000012165 I 0.000
ENSPFOG00000014020 Poecilia formosa ENSPFOG00000014020 I 0.000
ENSPFOG00000015347 Poecilia formosa ENSPFOG00000015347 I 0.000
ENSPFOG00000015708 Poecilia formosa ENSPFOG00000015708 I 0.000
ENSPFOG00000017491 Poecilia formosa ENSPFOG00000017491 I 0.000
ENSPFOG00000017586 Poecilia formosa ENSPFOG00000017586 I 0.000
ENSPFOG00000017687 Poecilia formosa ENSPFOG00000017687 I 0.000
ENSPFOG00000018165 Poecilia formosa ENSPFOG00000018165 I 0.000
ENSPFOG00000019324 Poecilia formosa ENSPFOG00000019324 I 0.000
ENSPFOG00000022945 Poecilia formosa ENSPFOG00000022945 I 0.000
ENSPFOG00000024523 Poecilia formosa ENSPFOG00000024523 I 0.000
ENSPMAG00000000894 Petromyzon marinus ENSPMAG00000000894 I 0.000
ENSPMAG00000001023 Petromyzon marinus ENSPMAG00000001023 I 0.000
ENSPMAG00000006507 Petromyzon marinus ENSPMAG00000006507 I 0.000
ENSPMAG00000010362 Petromyzon marinus ENSPMAG00000010362 I 0.000
ENSPMAG00000010400 Petromyzon marinus ENSPMAG00000010400 I 0.000
ENSPMAG00000010446 Petromyzon marinus ENSPMAG00000010446 I 0.000
ENSPPYG00000005239 Pongo abelii ENSPPYG00000005239 I 0.000
ENSPPYG00000005240 Pongo abelii ENSPPYG00000005240 I 0.000
ENSPPYG00000008896 Pongo abelii ENSPPYG00000008896 I 0.000
ENSPPYG00000012793 Pongo abelii ENSPPYG00000012793 I 0.000
ENSPPYG00000012963 Pongo abelii ENSPPYG00000012963 I 0.000
ENSPPYG00000014769 Pongo abelii ENSPPYG00000014769 I 0.000
ENSPPYG00000017706 Pongo abelii ENSPPYG00000017706 I 0.000
ENSPPYG00000018213 Pongo abelii ENSPPYG00000018213 I 0.000
ENSPSIG00000002737 Pelodiscus sinensis ENSPSIG00000002737 I 0.000
ENSPSIG00000003044 Pelodiscus sinensis ENSPSIG00000003044 I 0.000
ENSPSIG00000003067 Pelodiscus sinensis ENSPSIG00000003067 I 0.000
ENSPSIG00000006477 Pelodiscus sinensis ENSPSIG00000006477 I 0.000
ENSPSIG00000007309 Pelodiscus sinensis ENSPSIG00000007309 I 0.000
ENSPSIG00000012283 Pelodiscus sinensis ENSPSIG00000012283 I 0.000
ENSPSIG00000014871 Pelodiscus sinensis ENSPSIG00000014871 I 0.000
ENSPSIG00000015205 Pelodiscus sinensis ENSPSIG00000015205 I 0.000
EMX2 Pan troglodytes ENSPTRG00000002981 I 0.000
GSX1 Pan troglodytes ENSPTRG00000005735 I 0.000
PDX1 Pan troglodytes ENSPTRG00000005736 I 0.000
EMX1 Pan troglodytes ENSPTRG00000012055 I 0.000
HOXD3 Pan troglodytes ENSPTRG00000012672 I 0.000
GSX2 Pan troglodytes ENSPTRG00000016065 I 0.000
EN1 Pan troglodytes ENSPTRG00000016137 I 0.000
HOXA3 Pan troglodytes ENSPTRG00000019012 I 0.000
EN2 Pan troglodytes ENSPTRG00000028339 I 0.000
HOXB3 Pan troglodytes ENSPTRG00000040097 I 0.000
NKX1-1 Pan troglodytes ENSPTRG00000041220 I 0.000
HOXA3 Pteropus vampyrus ENSPVAG00000002486 I 0.000
EN2 Pteropus vampyrus ENSPVAG00000003106 I 0.000
GSX2 Pteropus vampyrus ENSPVAG00000003564 I 0.000
PDX1 Pteropus vampyrus ENSPVAG00000011521 I 0.000
OTP Pteropus vampyrus ENSPVAG00000011630 I 0.000
EMX2 Pteropus vampyrus ENSPVAG00000014458 I 0.000
HOXD3 Pteropus vampyrus ENSPVAG00000017421 I 0.000
Gsx1 Rattus norvegicus ENSRNOG00000000952 I 0.000
Hoxd3 Rattus norvegicus ENSRNOG00000001577 I 0.000
Gsx2 Rattus norvegicus ENSRNOG00000002266 I 0.000
Hoxa3 Rattus norvegicus ENSRNOG00000006281 I 0.000
En2 Rattus norvegicus ENSRNOG00000006846 I 0.000
Hoxb3 Rattus norvegicus ENSRNOG00000008313 I 0.000
Emx2 Rattus norvegicus ENSRNOG00000009482 I 0.000
Emx1 Rattus norvegicus ENSRNOG00000015493 I 0.000
Pdx1 Rattus norvegicus ENSRNOG00000046458 I 0.000
En1 Rattus norvegicus ENSRNOG00000056580 I 0.000
LOC108348320 Rattus norvegicus ENSRNOG00000061608 I 0.000
GSX1 Sorex araneus ENSSARG00000002493 I 0.000
HOXD3 Sorex araneus ENSSARG00000007917 I 0.000
ENSSHAG00000012284 Sarcophilus harrisii ENSSHAG00000012284 I 0.000
ENSSHAG00000013809 Sarcophilus harrisii ENSSHAG00000013809 I 0.000
ENSSHAG00000016090 Sarcophilus harrisii ENSSHAG00000016090 I 0.000
ENSSHAG00000016786 Sarcophilus harrisii ENSSHAG00000016786 I 0.000
ENSSHAG00000017591 Sarcophilus harrisii ENSSHAG00000017591 I 0.000
ENSSHAG00000017662 Sarcophilus harrisii ENSSHAG00000017662 I 0.000
ENSSHAG00000017812 Sarcophilus harrisii ENSSHAG00000017812 I 0.000
GSX2 Sus scrofa ENSSSCG00000008840 I 0.000
ENSSSCG00000009312 Sus scrofa ENSSSCG00000009312 I 0.000
GSX1 Sus scrofa ENSSSCG00000009313 I 0.000
EN1 Sus scrofa ENSSSCG00000015715 I 0.000
HOXD3 Sus scrofa ENSSSCG00000015985 I 0.000
ENSSSCG00000016419 Sus scrofa ENSSSCG00000016419 I 0.000
HOXA3 Sus scrofa ENSSSCG00000016705 I 0.000
HOXB3 Sus scrofa ENSSSCG00000017534 I 0.000
ENSSTOG00000012675 Ictidomys tridecemlineatus ENSSTOG00000012675 I 0.000
ENSSTOG00000014680 Ictidomys tridecemlineatus ENSSTOG00000014680 I 0.000
ENSSTOG00000021230 Ictidomys tridecemlineatus ENSSTOG00000021230 I 0.000
ENSSTOG00000021609 Ictidomys tridecemlineatus ENSSTOG00000021609 I 0.000
ENSSTOG00000023286 Ictidomys tridecemlineatus ENSSTOG00000023286 I 0.000
ENSSTOG00000025093 Ictidomys tridecemlineatus ENSSTOG00000025093 I 0.000
ENSSTOG00000025941 Ictidomys tridecemlineatus ENSSTOG00000025941 I 0.000
ENSSTOG00000027476 Ictidomys tridecemlineatus ENSSTOG00000027476 I 0.000
ENSSTOG00000028173 Ictidomys tridecemlineatus ENSSTOG00000028173 I 0.000
ENSSTOG00000029234 Ictidomys tridecemlineatus ENSSTOG00000029234 I 0.000
GSX2 Tupaia belangeri ENSTBEG00000004457 I 0.000
EMX2 Tupaia belangeri ENSTBEG00000014026 I 0.000
GSX1 Tupaia belangeri ENSTBEG00000014128 I 0.000
PDX1 Tupaia belangeri ENSTBEG00000014859 I 0.000
ENSTGUG00000000695 Taeniopygia guttata ENSTGUG00000000695 I 0.000
ENSTGUG00000002902 Taeniopygia guttata ENSTGUG00000002902 I 0.000
HOXB3 Taeniopygia guttata ENSTGUG00000003423 I 0.000
ENSTGUG00000007803 Taeniopygia guttata ENSTGUG00000007803 I 0.000
EMX2 Taeniopygia guttata ENSTGUG00000011076 I 0.000
ENSTGUG00000011603 Taeniopygia guttata ENSTGUG00000011603 I 0.000
ENSTGUG00000011604 Taeniopygia guttata ENSTGUG00000011604 I 0.000
ENSTGUG00000016803 Taeniopygia guttata ENSTGUG00000016803 I 0.000
hoxa4a Tetraodon nigroviridis ENSTNIG00000001754 I 0.000
hoxd3a Tetraodon nigroviridis ENSTNIG00000001764 I 0.000
emx2 Tetraodon nigroviridis ENSTNIG00000002977 I 0.000
GSX1 Tetraodon nigroviridis ENSTNIG00000010029 I 0.000
emx1 Tetraodon nigroviridis ENSTNIG00000010550 I 0.000
ENSTNIG00000010821 Tetraodon nigroviridis ENSTNIG00000010821 I 0.000
pdx1 Tetraodon nigroviridis ENSTNIG00000012708 I 0.000
en2a Tetraodon nigroviridis ENSTNIG00000012777 I 0.000
gsx2 Tetraodon nigroviridis ENSTNIG00000017658 I 0.000
ENSTNIG00000018144 Tetraodon nigroviridis ENSTNIG00000018144 I 0.000
pdx1 Takifugu rubripes ENSTRUG00000005693 I 0.000
ENSTRUG00000006182 Takifugu rubripes ENSTRUG00000006182 I 0.000
ENSTRUG00000009707 Takifugu rubripes ENSTRUG00000009707 I 0.000
ENSTRUG00000011240 Takifugu rubripes ENSTRUG00000011240 I 0.000
ENSTRUG00000012044 Takifugu rubripes ENSTRUG00000012044 I 0.000
EN1 Takifugu rubripes ENSTRUG00000012905 I 0.000
en1a Takifugu rubripes ENSTRUG00000014340 I 0.000
gsx2 Takifugu rubripes ENSTRUG00000015060 I 0.000
ENSTRUG00000015941 Takifugu rubripes ENSTRUG00000015941 I 0.000
GSX1 Takifugu rubripes ENSTRUG00000016892 I 0.000
hoxd3a Takifugu rubripes ENSTRUG00000017520 I 0.000
emx2 Takifugu rubripes ENSTRUG00000017831 I 0.000
en2a Takifugu rubripes ENSTRUG00000017873 I 0.000
ENSTSYG00000008312 Tarsius syrichta ENSTSYG00000008312 I 0.000
ENSTSYG00000012674 Tarsius syrichta ENSTSYG00000012674 I 0.000
EN1 Tursiops truncatus ENSTTRG00000001100 I 0.000
PDX1 Tursiops truncatus ENSTTRG00000002811 I 0.000
EMX2 Tursiops truncatus ENSTTRG00000005289 I 0.000
HOXA3 Tursiops truncatus ENSTTRG00000006769 I 0.000
EMX1 Tursiops truncatus ENSTTRG00000008543 I 0.000
GSX2 Tursiops truncatus ENSTTRG00000011491 I 0.000
HOXB3 Tursiops truncatus ENSTTRG00000012246 I 0.000
EN2 Tursiops truncatus ENSTTRG00000013702 I 0.000
HOXD3 Tursiops truncatus ENSTTRG00000013779 I 0.000
BARHL2 Vicugna pacos ENSVPAG00000005913 I 0.000
ENSXMAG00000000435 Xiphophorus maculatus ENSXMAG00000000435 I 0.000
ENSXMAG00000001045 Xiphophorus maculatus ENSXMAG00000001045 I 0.000
ENSXMAG00000001344 Xiphophorus maculatus ENSXMAG00000001344 I 0.000
ENSXMAG00000002496 Xiphophorus maculatus ENSXMAG00000002496 I 0.000
ENSXMAG00000005251 Xiphophorus maculatus ENSXMAG00000005251 I 0.000
ENSXMAG00000005721 Xiphophorus maculatus ENSXMAG00000005721 I 0.000
ENSXMAG00000007935 Xiphophorus maculatus ENSXMAG00000007935 I 0.000
ENSXMAG00000012980 Xiphophorus maculatus ENSXMAG00000012980 I 0.000
ENSXMAG00000014362 Xiphophorus maculatus ENSXMAG00000014362 I 0.000
ENSXMAG00000016469 Xiphophorus maculatus ENSXMAG00000016469 I 0.000
ENSXMAG00000019562 Xiphophorus maculatus ENSXMAG00000019562 I 0.000
ENSXMAG00000019769 Xiphophorus maculatus ENSXMAG00000019769 I 0.000
estExt_fgenesh2_pg.C_140022 Branchiostoma floridae estExt_fgenesh2_pg.C_140022 I 0.000
estExt_fgenesh2_pg.C_2100001 Branchiostoma floridae estExt_fgenesh2_pg.C_2100001 I 0.000
estExt_fgenesh2_pg.C_580080 Branchiostoma floridae estExt_fgenesh2_pg.C_580080 I 0.000
estExt_gwp.C_2590007 Branchiostoma floridae estExt_gwp.C_2590007 I 0.000
EVEC_0000662001 Enterobius vermicularis EVEC_0000662001 I 0.000
EVEC_0000811001 Enterobius vermicularis EVEC_0000811001 I 0.000
EVEC_0001353201 Enterobius vermicularis EVEC_0001353201 I 0.000
e_gw.53.179.1 Branchiostoma floridae e_gw.53.179.1 I 0.000
e_gw.53.97.1 Branchiostoma floridae e_gw.53.97.1 I 0.000
e_gw.549.21.1 Branchiostoma floridae e_gw.549.21.1 I 0.000
ems Drosophila melanogaster FBgn0000576 D 0.000
en Drosophila melanogaster FBgn0000577 D 0.000
inv Drosophila melanogaster FBgn0001269 D 0.000
zen Drosophila melanogaster FBgn0004053 D 0.000
zen2 Drosophila melanogaster FBgn0004054 D 0.000
E5 Drosophila melanogaster FBgn0008646 D 0.000
en Drosophila virilis FBgn0013111 I 0.000
zen Drosophila virilis FBgn0013150 I 0.000
en Drosophila pseudoobscura FBgn0020475 I 0.000
ind Drosophila melanogaster FBgn0025776 D 0.000
en Drosophila simulans FBgn0044189 I 0.000
en Drosophila sechellia FBgn0044210 I 0.000
GA10340 Drosophila pseudoobscura FBgn0070398 I 0.000
GA14690 Drosophila pseudoobscura FBgn0074717 I 0.000
GA15560 Drosophila pseudoobscura FBgn0075577 I 0.000
GF10750 Drosophila ananassae FBgn0087790 I 0.000
GF12393 Drosophila ananassae FBgn0089430 I 0.000
GF12559 Drosophila ananassae FBgn0089596 I 0.000
GF16103 Drosophila ananassae FBgn0093125 I 0.000
GF17795 Drosophila ananassae FBgn0094813 I 0.000
GF17797 Drosophila ananassae FBgn0094815 I 0.000
GF18902 Drosophila ananassae FBgn0095916 I 0.000
GG10235 Drosophila erecta FBgn0102545 I 0.000
GG10258 Drosophila erecta FBgn0102567 I 0.000
GG13695 Drosophila erecta FBgn0105958 I 0.000
GG17017 Drosophila erecta FBgn0109245 I 0.000
GG19873 Drosophila erecta FBgn0112074 I 0.000
GG20207 Drosophila erecta FBgn0112398 I 0.000
GG22644 Drosophila erecta FBgn0114815 I 0.000
GH14408 Drosophila grimshawi FBgn0121884 I 0.000
GH16676 Drosophila grimshawi FBgn0124147 I 0.000
GH17404 Drosophila grimshawi FBgn0124874 I 0.000
GH18130 Drosophila grimshawi FBgn0125598 I 0.000
GH19481 Drosophila grimshawi FBgn0126946 I 0.000
GH20500 Drosophila grimshawi FBgn0127963 I 0.000
GH21390 Drosophila grimshawi FBgn0128852 I 0.000
GH23539 Drosophila grimshawi FBgn0130996 I 0.000
GI10044 Drosophila mojavensis FBgn0132810 I 0.000
GI11362 Drosophila mojavensis FBgn0134123 I 0.000
GI13996 Drosophila mojavensis FBgn0136750 I 0.000
GI18568 Drosophila mojavensis FBgn0141307 I 0.000
GI21047 Drosophila mojavensis FBgn0143779 I 0.000
GI22735 Drosophila mojavensis FBgn0145462 I 0.000
GI22889 Drosophila mojavensis FBgn0145616 I 0.000
GI24719 Drosophila mojavensis FBgn0147441 I 0.000
GL10677 Drosophila persimilis FBgn0148287 I 0.000
GL11415 Drosophila persimilis FBgn0149024 I 0.000
GL21773 Drosophila persimilis FBgn0159366 I 0.000
GL22044 Drosophila persimilis FBgn0159636 I 0.000
GL23326 Drosophila persimilis FBgn0160916 I 0.000
GL24224 Drosophila persimilis FBgn0161814 I 0.000
GL25910 Drosophila persimilis FBgn0163494 I 0.000
GM10527 Drosophila sechellia FBgn0165473 I 0.000
GM10529 Drosophila sechellia FBgn0165475 I 0.000
GM21295 Drosophila sechellia FBgn0176176 I 0.000
GM24141 Drosophila sechellia FBgn0179005 I 0.000
GM24515 Drosophila sechellia FBgn0179378 I 0.000
GM25901 Drosophila sechellia FBgn0180757 I 0.000
GD10802 Drosophila simulans FBgn0182565 I 0.000
GD12586 Drosophila simulans FBgn0184313 I 0.000
GD18937 Drosophila simulans FBgn0190448 I 0.000
GD19522 Drosophila simulans FBgn0191017 I 0.000
GD19524 Drosophila simulans FBgn0191019 I 0.000
GD20470 Drosophila simulans FBgn0191941 I 0.000
GJ11617 Drosophila virilis FBgn0198872 I 0.000
GJ20363 Drosophila virilis FBgn0207503 I 0.000
GJ22569 Drosophila virilis FBgn0209676 I 0.000
GJ23303 Drosophila virilis FBgn0210405 I 0.000
GJ24670 Drosophila virilis FBgn0211747 I 0.000
GK10829 Drosophila willistoni FBgn0212840 I 0.000
GK12250 Drosophila willistoni FBgn0214260 I 0.000
GK17410 Drosophila willistoni FBgn0219409 I 0.000
GK22074 Drosophila willistoni FBgn0224059 I 0.000
GK22225 Drosophila willistoni FBgn0224210 I 0.000
GK22485 Drosophila willistoni FBgn0224462 I 0.000
GK22678 Drosophila willistoni FBgn0224655 I 0.000
GE12367 Drosophila yakuba FBgn0230114 I 0.000
GE13516 Drosophila yakuba FBgn0231183 I 0.000
GE19990 Drosophila yakuba FBgn0237317 I 0.000
GE24407 Drosophila yakuba FBgn0241525 I 0.000
GE25830 Drosophila yakuba FBgn0242880 I 0.000
GE25832 Drosophila yakuba FBgn0242882 I 0.000
GE26304 Drosophila yakuba FBgn0243334 I 0.000
zen Drosophila pseudoobscura FBgn0243538 I 0.000
GA23649 Drosophila pseudoobscura FBgn0245049 I 0.000
GA30153 Drosophila pseudoobscura FBgn0263055 I 0.000
fgenesh2_pg.scaffold_259000002 Branchiostoma floridae fgenesh2_pg.scaffold_259000002 I 0.000
fgenesh2_pg.scaffold_402000006 Branchiostoma floridae fgenesh2_pg.scaffold_402000006 I 0.000
fgenesh2_pg.scaffold_523000002 Branchiostoma floridae fgenesh2_pg.scaffold_523000002 I 0.000
fgenesh2_pm.scaffold_210000001 Branchiostoma floridae fgenesh2_pm.scaffold_210000001 I 0.000
FOMPIDRAFT_1062989 Fomitopsis pinicola FOMPIDRAFT_1062989 N 0.000
GB51301 Apis mellifera GB51301 I 0.000
GB52912 Apis mellifera GB52912 I 0.000
GB54518 Apis mellifera GB54518 I 0.000
GB55322 Apis mellifera GB55322 I 0.000
GB55332 Apis mellifera GB55332 I 0.000
GB55360 Apis mellifera GB55360 I 0.000
Gfo_R008324 Geospiza fortis Gfo_R008324 I 0.000
Gfo_R014727 Geospiza fortis Gfo_R014727 I 0.000
Gfo_R015843 Geospiza fortis Gfo_R015843 I 0.000
GPLIN_000177500 Globodera pallida GPLIN_000177500 I 0.000
GPLIN_000561600 Globodera pallida GPLIN_000561600 I 0.000
GPLIN_001342700 Globodera pallida GPLIN_001342700 I 0.000
GPUH_0000001901 Gongylonema pulchrum GPUH_0000001901 I 0.000
GPUH_0002067401 Gongylonema pulchrum GPUH_0002067401 I 0.000
gw.24.415.1 Branchiostoma floridae gw.24.415.1 I 0.000
Hba_17613 Heterorhabditis bacteriophora Hba_17613 I 0.000
Hba_19829 Heterorhabditis bacteriophora Hba_19829 I 0.000
HCOI00015300 Haemonchus contortus HCOI00015300 I 0.000
HCOI00511300 Haemonchus contortus HCOI00511300 I 0.000
HCOI00745800 Haemonchus contortus HCOI00745800 I 0.000
HDID_0000029301 Hymenolepis diminuta HDID_0000029301 I 0.000
HDID_0000786301 Hymenolepis diminuta HDID_0000786301 I 0.000
HelroG100536 Helobdella robusta HelroG100536 I 0.000
HelroG127402 Helobdella robusta HelroG127402 I 0.000
HelroG134799 Helobdella robusta HelroG134799 I 0.000
HelroG150820 Helobdella robusta HelroG150820 I 0.000
HelroG153720 Helobdella robusta HelroG153720 I 0.000
HelroG72685 Helobdella robusta HelroG72685 I 0.000
HelroG76140 Helobdella robusta HelroG76140 I 0.000
HelroG78875 Helobdella robusta HelroG78875 I 0.000
HelroG98619 Helobdella robusta HelroG98619 I 0.000
HMEL009342 Heliconius melpomene HMEL009342 I 0.000
HMEL009343 Heliconius melpomene HMEL009343 I 0.000
HMEL014770 Heliconius melpomene HMEL014770 I 0.000
HMEL025052 Heliconius melpomene HMEL025052 I 0.000
HmN_000638300 Hymenolepis microstoma HmN_000638300 I 0.000
HNAJ_0001006601 Hymenolepis nana HNAJ_0001006601 I 0.000
HPBE_0000967901 Heligmosomoides bakeri HPBE_0000967901 I 0.000
HPLM_0001128001 Haemonchus placei HPLM_0001128001 I 0.000
Hsal_01792--XP_394125.3_APIME Harpegnathos saltator Hsal_01792--XP_394125.3_APIME I 0.000
Hsal_03841--XP_001120954.1_APIME Harpegnathos saltator Hsal_03841--XP_001120954.1_APIME I 0.000
Hsal_04407--XP_001121097.1_APIME Harpegnathos saltator Hsal_04407--XP_001121097.1_APIME I 0.000
Hsal_07250--XP_624481.2_APIME Harpegnathos saltator Hsal_07250--XP_624481.2_APIME I 0.000
Hsal_07413--XP_001121029.1_APIME Harpegnathos saltator Hsal_07413--XP_001121029.1_APIME I 0.000
ISCW008920 Ixodes scapularis ISCW008920 I 0.000
ISCW021083 Ixodes scapularis ISCW021083 I 0.000
ISCW022797 Ixodes scapularis ISCW022797 I 0.000
ISCW024206 Ixodes scapularis ISCW024206 I 0.000
ISCW024267 Ixodes scapularis ISCW024267 I 0.000
KGM_00318 Danaus plexippus KGM_00318 I 0.000
KGM_01519 Danaus plexippus KGM_01519 I 0.000
KGM_13122 Danaus plexippus KGM_13122 I 0.000
L596_g19522 Steinernema carpocapsae L596_g19522 I 0.000
L596_g3163 Steinernema carpocapsae L596_g3163 I 0.000
L596_g4959 Steinernema carpocapsae L596_g4959 I 0.000
L798_01064 Zootermopsis nevadensis L798_01064 I 0.000
L798_09740 Zootermopsis nevadensis L798_09740 I 0.000
L798_13009 Zootermopsis nevadensis L798_13009 I 0.000
L889_g11270 Steinernema feltiae L889_g11270 I 0.000
L889_g11566 Steinernema feltiae L889_g11566 I 0.000
L889_g22989 Steinernema feltiae L889_g22989 I 0.000
L892_g20023 Steinernema scapterisci L892_g20023 I 0.000
L892_g25012 Steinernema scapterisci L892_g25012 I 0.000
L892_g9503 Steinernema scapterisci L892_g9503 I 0.000
L893_g12480 Steinernema glaseri L893_g12480 I 0.000
L893_g1824 Steinernema glaseri L893_g1824 I 0.000
L893_g26530 Steinernema glaseri L893_g26530 I 0.000
L893_g27804 Steinernema glaseri L893_g27804 I 0.000
L898_g229 Steinernema monticolum L898_g229 I 0.000
L898_g5445 Steinernema monticolum L898_g5445 I 0.000
L898_g5584 Steinernema monticolum L898_g5584 I 0.000
LCUP000250 Lucilia cuprina LCUP000250 I 0.000
LCUP000251 Lucilia cuprina LCUP000251 I 0.000
LCUP002254 Lucilia cuprina LCUP002254 N 0.000
LCUP005190 Lucilia cuprina LCUP005190 I 0.000
LCUP005192 Lucilia cuprina LCUP005192 I 0.000
LCUP009050 Lucilia cuprina LCUP009050 I 0.000
LCUP009051 Lucilia cuprina LCUP009051 I 0.000
LCUP010472 Lucilia cuprina LCUP010472 I 0.000
LDEC000894 Leptinotarsa decemlineata LDEC000894 I 0.000
LDEC000916 Leptinotarsa decemlineata LDEC000916 I 0.000
LDEC016261 Leptinotarsa decemlineata LDEC016261 I 0.000
LLOJ002553 Lutzomyia longipalpis LLOJ002553 I 0.000
LLOJ002597 Lutzomyia longipalpis LLOJ002597 I 0.000
LLOJ003079 Lutzomyia longipalpis LLOJ003079 I 0.000
LLOJ004353 Lutzomyia longipalpis LLOJ004353 I 0.000
LLOJ007159 Lutzomyia longipalpis LLOJ007159 I 0.000
LOAG_00921 Loa loa LOAG_00921 I 0.000
LOAG_02387 Loa loa LOAG_02387 I 0.000
LOAG_12921 Loa loa LOAG_12921 I 0.000
LOAG_17577 Loa loa LOAG_17577 N 0.000
LotgiG100678 Lottia gigantea LotgiG100678 I 0.000
LotgiG110641 Lottia gigantea LotgiG110641 I 0.000
LotgiG120200 Lottia gigantea LotgiG120200 I 0.000
LotgiG219971 Lottia gigantea LotgiG219971 I 0.000
LotgiG58125 Lottia gigantea LotgiG58125 I 0.000
LotgiG80119 Lottia gigantea LotgiG80119 I 0.000
LotgiG99857 Lottia gigantea LotgiG99857 I 0.000
maker-nMf.1.1.scaf00145-augustus-gene-0.13 Meloidogyne floridensis maker-nMf.1.1.scaf00145-augustus-gene-0.13 I 0.000
maker-nMf.1.1.scaf03150-augustus-gene-0.8 Meloidogyne floridensis maker-nMf.1.1.scaf03150-augustus-gene-0.8 I 0.000
maker-nMf.1.1.scaf04426-augustus-gene-0.4 Meloidogyne floridensis maker-nMf.1.1.scaf04426-augustus-gene-0.4 I 0.000
MCINX000220 Melitaea cinxia MCINX000220 I 0.000
MCINX000309 Melitaea cinxia MCINX000309 I 0.000
MCINX005606 Melitaea cinxia MCINX005606 I 0.000
MCINX008421 Melitaea cinxia MCINX008421 I 0.000
MCINX010503 Melitaea cinxia MCINX010503 I 0.000
MCINX014501 Melitaea cinxia MCINX014501 I 0.000
MCOS_0000216701 Mesocestoides corti MCOS_0000216701 I 0.000
MCOS_0000811201 Mesocestoides corti MCOS_0000811201 I 0.000
MDOA002777 Musca domestica MDOA002777 I 0.000
MDOA004864 Musca domestica MDOA004864 I 0.000
MDOA005095 Musca domestica MDOA005095 I 0.000
MDOA005894 Musca domestica MDOA005894 I 0.000
MDOA008087 Musca domestica MDOA008087 I 0.000
MDOA011121 Musca domestica MDOA011121 I 0.000
MDOA012216 Musca domestica MDOA012216 I 0.000
MDOA013052 Musca domestica MDOA013052 I 0.000
MESCA003890 Megaselia scalaris MESCA003890 I 0.000
MESCA011262 Megaselia scalaris MESCA011262 I 0.000
Minc03173 Meloidogyne incognita Minc03173 I 0.000
Minc03202 Meloidogyne incognita Minc03202 I 0.000
Minc04053 Meloidogyne incognita Minc04053 I 0.000
Minc05717 Meloidogyne incognita Minc05717 I 0.000
ML02215a Mnemiopsis leidyi ML02215a I 0.000
Myotis_brandtii_EMX1_10023122 Myotis brandtii Myotis_brandtii_EMX1_10023122 I 0.000
Myotis_brandtii_EMX2_10024925 Myotis brandtii Myotis_brandtii_EMX2_10024925 I 0.000