TF Information

OBART03G39990 *(Oryza barthii)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	OBART03G39990	T254970_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL16 M06987_2.00	Arabidopsis thaliana	TWCCHAAWDDGGWAA	TTWCCHHWTTDGGWA	Dap-seq OMalley et al.(2016) AGL16_col_a	0.721	0.721
AGL16 M06988_2.00	Arabidopsis thaliana	WDWNTTWCCHWAWWDGGAAAS	STTTCCHWWTWDGGWAANWHW	Dap-seq OMalley et al.(2016) AGL16_colamp_a	0.721	0.721
Q9LEI1_HORVU M10984_2.00	Hordeum vulgare	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BM7_01	0.721	0.721
MADS1 M10969_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS1_02	0.721	0.721
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
OBART03G39990.1	MADS box	1	43	MTSRQVTSGKHRNDLLKKAYELALLCDAEIGLIIFSSRGRLCC

Links
Other MADS box family TFs
Other *Oryza barthii* TFs

Invalid Input OrderBy

65 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action