TF Information

Sb02g005005 *(Sorghum bicolor)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00319 (SRF-TF)	IPR002100	Sb02g005005	T256039_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AG M02695_2.00	Arabidopsis thaliana	HTTWCCWWAWNDGGHADN	NHTDCCHNWTWWGGWAAD	SELEX Mathelier et al.(2014) MA0005.2	0.718	0.718
AG M10923_2.00	Arabidopsis thaliana	HTTWCCWWAWNDGGHWDN	NHTDCCHNWTWWGGWAAD	Transfac Matys et al.(2006) P$AG_01	0.718	0.718
AG M10924_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AG_02	0.718	0.718
AG M10925_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AG_03	0.718	0.718
AG_TOBAC M10995_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AG1_02	0.718	0.718
AG M10926_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AG_Q2	0.718	0.718
Q08711_PETHY M10999_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP6_01	0.718	0.718
MADS3_ORYSJ M10963_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS3_01	0.718	0.718
AG_PETHY M10994_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS3_02	0.718	0.718
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
Sb02g005005.1	MADS box	85	123	CIENTMNHHVTFCKCRNGTYELSVLCNAKVVLIVLSSRL

Links
Other MADS box family TFs
Other *Sorghum bicolor* TFs

Invalid Input OrderBy

14 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action