TF Information

mgf017475m *(Mimulus guttatus)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	mgf017475m	T257420_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL15 M06992_2.00	Arabidopsis thaliana	WNTTWCCHAAWDWRGAAAN	NTTTCYWHWTTDGGWAANW	Dap-seq OMalley et al.(2016) AGL15_col_a	0.708	0.708
AGL15 M06993_2.00	Arabidopsis thaliana	DNTTWCCHAAWDDRGAAANHH	DDNTTTCYHHWTTDGGWAANH	Dap-seq OMalley et al.(2016) AGL15_colamp_a	0.708	0.708
AGL15 M10927_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL15_01	0.708	0.708
AGL15 M10928_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL15_02	0.708	0.708
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
mgf017475m	MADS box	10	57	EIENNSARMVCFSKRRSGLIKKAKELSVLCDVDVATIFFSKSGKLYQY

Links
Other MADS box family TFs
Other *Mimulus guttatus* TFs

Invalid Input OrderBy

21 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action