TF Information

PK24279.1 *(Cannabis sativa)* MADS box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00319 (SRF-TF)	IPR002100	PK24279.1	T259257_2.00	Misc (2018-Jan-19)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
AGL67 M10907_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AT1G77950_01	0.765	0.765
AGL42 M06995_2.00	Arabidopsis thaliana	RATGATG	CATCATY	Dap-seq OMalley et al.(2016) AGL42_col_a	0.706	0.706
AGL1 M02694_2.00	Arabidopsis thaliana	NDTDCCWWWWNDGGWAHN	NDTWCCHNWWWWGGHAHN	SELEX Mathelier et al.(2014) MA0585.1	0.706	0.706
AGL1 M10920_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL1_01	0.706	0.706
AGL1 M10921_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$AGL1_02	0.706	0.706
Q9ATE7_PETHY M11010_2.00	Petunia x hybrida	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$FBP22_01	0.706	0.706
Q9LM09_TOBAC M11016_2.00	Nicotiana tabacum	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS4_01	0.706	0.706
MADS5 M10970_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$MADS5_02	0.706	0.706
SHP2 M10914_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$SHP2_01	0.706	0.706
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PK24279.1	MADS box	1	34	RRNGLIKKAYELSVLCDVDLALVMFSPSGRLSFF

Links
Other MADS box family TFs
Other *Cannabis sativa* TFs

Invalid Input OrderBy

32 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action