CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

KGM_19741 *(Danaus plexippus)* Paired box
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00292 (PAX)	IPR001523	KGM_19741	T311955_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
Poxn M03946_2.00	Drosophila melanogaster	DGCGTGACSGTCACGSY	RSCGTGACSGTCACGCH	SELEX Nitta et al.(2015) Poxn_1	0.719	0.719
Poxn M03947_2.00	Drosophila melanogaster	RSCGKGACSGTTMCGSW	WSCGKAACSGTCMCGSY	SELEX Nitta et al.(2015) Poxn_2	0.719	0.719
Poxn M03948_2.00	Drosophila melanogaster	NCGTTCCGGAACGD	HCGTTCCGGAACGN	SELEX Nitta et al.(2015) Poxn_3	0.719	0.719
Poxn M06437_2.00	Drosophila melanogaster	RSCGTGACG	CGTCACGSY	B1H Zhu et al.(2011) Poxn_SOLEXA_5_FBgn0003130	0.719	0.719
For this family, TFs with SR scores > 0.700* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EHJ77384	Paired box	1	32	MFAWEIRERLLSARVCEPHSIPSVSSVNRILR

Links
Other Paired box family TFs
Other *Danaus plexippus* TFs