TF Information

PGSC0003DMG400020608 *(Solanum tuberosum)* WRKY
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF03106 (WRKY)	IPR003657	PGSC0003DMG400020608	T354281_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
WRKY70 M07399_2.00	Arabidopsis thaliana	HAAAGTCAACGNN	NNCGTTGACTTTD	Dap-seq OMalley et al.(2016) WRKY70_col	0.843	0.633
WRKY46 M07395_2.00	Arabidopsis thaliana	VAAAGTCAAMG	CKTTGACTTTB	Dap-seq OMalley et al.(2016) WRKY46_col_a	0.813	0.550
WRKY46 M07396_2.00	Arabidopsis thaliana	HRAAGTCAACG	CGTTGACTTYD	Dap-seq OMalley et al.(2016) WRKY46_colamp_a	0.813	0.550
For this family, TFs with SR scores > 0.808* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
PGSC0003DMT400053122	WRKY	116	177	NDGCAWRKYGQKKILNSKYPRCYYRCTHKYDQECRATKQVQIIQENPIKMYHTTYFGNHTCN

Links
Other WRKY family TFs
Other *Solanum tuberosum* TFs

Invalid Input OrderBy

216 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action