CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

ORGLA02G0180000 *(Oryza glaberrima)* bHLH
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00010 (HLH)	IPR001092	ORGLA02G0180000	T042887_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
UNE10 M01705_2.00	Arabidopsis thaliana	HCACGTGM	KCACGTGD	PBM Weirauch et al.(2014) pTH8112	0.857	0.646
BIM1 M01710_2.00	Arabidopsis thaliana	NCRCGTGNNN	NNNCACGYGN	PBM Weirauch et al.(2014) pTH8114	0.851	0.521
BIM1 M06739_2.00	Arabidopsis thaliana	CACGTGAYNHNNNH	DNNNDNRTCACGTG	Dap-seq OMalley et al.(2016) BIM1_col_a	0.851	0.521
BIM1 M06740_2.00	Arabidopsis thaliana	NVKCACGTGMYHHNHNHNHNNN	NNNDNDNDNDDRKCACGTGMBN	Dap-seq OMalley et al.(2016) BIM1_colamp_a	0.851	0.521
BIM1 M09787_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$BIM1_01	0.851	0.521
e_gw1.209.40.1 M01756_2.00	Physcomitrella patens	NNCACGTGNN	NNCACGTGNN	PBM Weirauch et al.(2014) pTH8070	0.846	0.896
LRL2 M06738_2.00	Arabidopsis thaliana	CACGTGSVDMNCACG	CGTGNKHBSCACGTG	Dap-seq OMalley et al.(2016) bHLH69_col_a	0.846	0.854
For this family, TFs with SR scores > 0.838* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
ORGLA02G0180000.1	bHLH	323	370	DPHSIAERLRREKISDRMKDLQELVPNSNKTNKASMLDEIIDYVKFLQ

Links
Other bHLH family TFs
Other *Oryza glaberrima* TFs