CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

TCM_042471 *(Theobroma cacao)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source	Animal TF db
PF00847 (AP2)	IPR001471	TCM_042471	T005671_2.00	Ensembl (2018-Dec-8)	Link out
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
abi4 M02648_2.00	Zea mays	CGSYGCYBYB	VRVRGCRSCG	SELEX Mathelier et al.(2014) MA0123.1	0.793	0.920
abi4 M09706_2.00	Zea mays	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$ABI4_01	0.793	0.920
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
EOY17725	AP2	73	124	FRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGS

Links
Other AP2 family TFs
Other *Theobroma cacao* TFs