CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

30190.m011119 *(Ricinus communis)* AP2
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00847 (AP2)	IPR001471	30190.m011119	T006774_2.00	JGI (2012-Mar-17)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
ddf2 M00965_2.00	Arabidopsis lyrata	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_lyrata	0.748	0.760
DREB1F M00962_2.00	Arabidopsis thaliana	NRCCGACNN	NNGTCGGYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_thaliana	0.734	0.780
DREB1F M00840_2.00	Arabidopsis thaliana	NRYCGACNN	NNGTCGRYN	PBM Franco-Zorrilla et al.(2014) DDF1	0.734	0.780
DDF1 M00964_2.00	Arabidopsis lyrata	NRYCGACDY	RHGTCGRYN	PBM LehtiShiu et al.(2015) DDF1_Arabidopsis_lyrata	0.734	0.780
DREB1F M06564_2.00	Arabidopsis thaliana	NHNHYGYCGACATNN	NNATGTCGRCRDNDN	Dap-seq OMalley et al.(2016) DDF1_col_a	0.734	0.780
DREB1F M06565_2.00	Arabidopsis thaliana	HNDNNRYCGACAH	DTGTCGRYNNHND	Dap-seq OMalley et al.(2016) DDF1_colamp_a	0.734	0.780
DREB1F M09701_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1F_03	0.734	0.780
DREB1D M06678_2.00	Arabidopsis thaliana	NHBRCCGACRTNN	NNAYGTCGGYVDN	Dap-seq OMalley et al.(2016) CBF4_col_a	0.721	0.840
DREB1D M06679_2.00	Arabidopsis thaliana	HYRCCGACATND	HNATGTCGGYRD	Dap-seq OMalley et al.(2016) CBF4_colamp_a	0.721	0.840
DREB1A M01624_2.00	Arabidopsis thaliana	NRCCGACNNN	NNNGTCGGYN	PBM Weirauch et al.(2014) pTH8163	0.718	0.820
DREB1A M01625_2.00	Arabidopsis thaliana	NNRCCGACNW	WNGTCGGYNN	PBM Weirauch et al.(2014) pTH9718	0.718	0.820
DREB1A M06641_2.00	Arabidopsis thaliana	HNYBRCCGACDWNN	NNWHGTCGGYVRND	Dap-seq OMalley et al.(2016) CBF3_col_a	0.718	0.820
DREB1A M06642_2.00	Arabidopsis thaliana	YBRCCGACATN	NATGTCGGYVR	Dap-seq OMalley et al.(2016) CBF3_colamp_a	0.718	0.820
DREB1C M01623_2.00	Arabidopsis thaliana	RCCGACAT	ATGTCGGY	PBM Weirauch et al.(2014) pTH8187	0.683	0.760
DREB1C M06639_2.00	Arabidopsis thaliana	NNNHBRCCGACATNN	NNATGTCGGYVDNNN	Dap-seq OMalley et al.(2016) CBF2_col_a	0.683	0.760
DREB1C M06640_2.00	Arabidopsis thaliana	NYBRCCGACATVN	NBATGTCGGYVRN	Dap-seq OMalley et al.(2016) CBF2_colamp_a	0.683	0.760
DREB1E M00963_2.00	Arabidopsis thaliana	NRYCGACAT	ATGTCGRYN	PBM LehtiShiu et al.(2015) DDF2_Arabidopsis_thaliana	0.682	0.720
DREB1E M06589_2.00	Arabidopsis thaliana	NNNYYGYCGACATVD	HBATGTCGRCRRNNN	Dap-seq OMalley et al.(2016) DDF2_col_a	0.682	0.720
DREB1E M09702_2.00	Arabidopsis thaliana	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1E_03	0.682	0.720
DREB1G M01635_2.00	Oryza sativa	NYGCCGACAN	NTGTCGGCRN	PBM Weirauch et al.(2014) pTH8352	0.680	0.780
DREB1G M09707_2.00	Oryza sativa	Transfac license required	Transfac license required	Transfac Matys et al.(2006) P$DREB1G_01	0.680	0.780
For this family, TFs with SR scores > 0.677* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
30190.m011119	AP2	66	117	PVFRGVRRRNGNKWVCEVRVPNKKSRIWLGTYPTPEMAARAHDVAALALRGK

Links
Other AP2 family TFs
Other *Ricinus communis* TFs

168 Related TFs

Name	Species	Gene ID	Motif Evidence	SR Score	Action
SEPMUDRAFT_49494	Sphaerulina musiva	SEPMUDRAFT_49494	N	0.000
fgenesh1_pg.C_scaffold_11000317	Mycosphaerella fijiensis	fgenesh1_pg.C_scaffold_11000317	N	0.000

30190.m011119 (Ricinus communis) AP2

TF Information

Directly determined binding motifs

Motifs from related TFs

DNA Binding Domains

Links

168 Related TFs

30190.m011119 **(Ricinus communis)
AP2**