CIS-BP Database: Catalog of Inferred Sequence Binding Preferences

TF Information

L892_g17612 *(Steinernema scapterisci)* Nuclear receptor
Pfam ID	Interpro ID	Gene ID	CIS-BP ID	Sequence source
PF00105 (zf-C4)	IPR001628	L892_g17612	T309211_2.00	WormBase:ParaSite (2015-Oct-22)
Directly determined binding motifs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
No direct experiments
Motifs from related TFs
Name/Motif ID	Species	Forward	Reverse	Type/Study/Study ID	SR Score	DBD Identity
nhr-49 M02413_2.00	Caenorhabditis elegans	NNNNWNHAN	NTDNWNNNN	PBM Weirauch et al.(2014) pTH5891	0.926	0.614
nhr-1 M00686_2.00	Caenorhabditis elegans	ARTGATCA	TGATCAYT	PBM Narasimhan et al.(2015) pTH9322	0.887	0.557
nhr-154 M00698_2.00	Caenorhabditis elegans	NRBRYCAHWD	HWDTGRYVYN	PBM Narasimhan et al.(2015) pTH10650	0.822	0.600
CBG23380 M01296_2.00	Caenorhabditis briggsae	NDBDHHANWN	NWNTDDHVHN	PBM Lambert et al.(2019) pTH11449	0.818	0.600
nhr-204 M00704_2.00	Caenorhabditis elegans	NDNTGRTMHN	NDKAYCANHN	PBM Narasimhan et al.(2015) pTH10028	0.800	0.500
CBG26996_CONSTRUCT M01300_2.00	PBM CONSTRUCTS	NNNNTGRWMN	NKWYCANNNN	PBM Lambert et al.(2019) pTH11460	0.748	0.457
For this family, TFs with SR scores > 0.745* will likely have a similar motif*

DNA Binding Domains

Protein ID	Domain	From	To	Sequence
L892_g17612.t1	Nuclear receptor	78	147	LKCVVCGDRPTGYHYDVLSCNGCKTFFRRTVIANRKFACTRGGKCEFTKDFRCACRACRFQKCVQAGMNV

Links
Other Nuclear receptor family TFs
Other *Steinernema scapterisci* TFs